SAXSdb — 4wwr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquitin-like protein 4A

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Large proline-rich protein BAG6 × 1 （P46379） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Large proline-rich protein BAG6 × 1 （P46379） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Large proline-rich protein BAG6 × 1 （P46379） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Large proline-rich protein BAG6 × 1 （P46379） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBL4A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–47； UniProt 93–139 Author chain D； PDBConstruct 1–47； UniProt 93–139 Author chain F； PDBConstruct 1–47； UniProt 93–139 Author chain H； PDBConstruct 1–47； UniProt 93–139

Large proline-rich protein BAG6

Homo sapiens

UniProt P46379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Ubiquitin-like protein 4A × 1 （P11441） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Ubiquitin-like protein 4A × 1 （P11441） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Ubiquitin-like protein 4A × 1 （P11441） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Ubiquitin-like protein 4A × 1 （P11441） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BAG6_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 2–53； UniProt 1060–1111 Author chain C； PDBConstruct 2–53； UniProt 1060–1111 Author chain E； PDBConstruct 2–53； UniProt 1060–1111 Author chain G； PDBConstruct 2–53； UniProt 1060–1111

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4wwr
Deposition date deposition_date	2014-11-12
Structure title title	Crystal Structure of Bag6-Ubl4A Dimerization Domain
Keywords keywords	Endoplasmic Reticulum, Recombinant Proteins, Human, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4wwr__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4wwr__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4wwr__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.98 Å
Rg (electron density)	13.76 Å
Total Rg	15.02 Å
Atom count	1592
Residues	98
Excluded volume	13927 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4wwr__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4wwr__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4wwr__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4wwr__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Ubiquitin-like protein 4A
Molecular weight formula_weight	5503.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,H,D,F
Atom count atom_count	6530

PQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Large proline-rich protein BAG6
Molecular weight formula_weight	5931.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G,C,E

MQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	129

▶

Unit-cell length a length_a	47.235 Å
Unit-cell length b length_b	56.494 Å
Unit-cell length c length_c	75.545 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	96.23 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	19.647 Å
R factor r_factor	0.2267
R_work r_work	0.2245
R_free r_free	0.2688

Crystal Structure of Bag6-Ubl4A Dimerization Domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquitin-like protein 4A

State in the Current Structure

Other States of the Same Protein in the Database

Large proline-rich protein BAG6

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4wwr__assembly_4__model_1

4wwr__assembly_4__model_1 | I(q)

4wwr__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Crystal Structure of Bag6-Ubl4A Dimerization Domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquitin-like protein 4A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large proline-rich protein BAG6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4wwr__assembly_4__model_1

4wwr__assembly_4__model_1 | I(q)

4wwr__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)