SAXSdb — 5b0o

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellum-specific ATP synthase

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Flagellar assembly protein FliH × 2 （P15934） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Flagellar assembly protein FliH × 2 （P15934） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Flagellar assembly protein FliH × 2 （P15934） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Flagellar assembly protein FliH × 2 （P15934） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLII_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–456； UniProt 1–456 Author chain B； PDBConstruct 1–456； UniProt 1–456 Author chain C； PDBConstruct 1–456； UniProt 1–456 Author chain D； PDBConstruct 1–456； UniProt 1–456

Flagellar assembly protein FliH

Salmonella typhimurium

UniProt P15934

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Flagellum-specific ATP synthase × 1 （P26465） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Flagellum-specific ATP synthase × 1 （P26465） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Flagellum-specific ATP synthase × 1 （P26465） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Flagellum-specific ATP synthase × 1 （P26465） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIH_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 4–140； UniProt 99–235 Author chain F； PDBConstruct 4–140； UniProt 99–235 Author chain G； PDBConstruct 4–140； UniProt 99–235 Author chain H； PDBConstruct 4–140； UniProt 99–235 Author chain I； PDBConstruct 4–140； UniProt 99–235 Author chain J； PDBConstruct 4–140； UniProt 99–235 Author chain K； PDBConstruct 4–140； UniProt 99–235 Author chain L； PDBConstruct 4–140； UniProt 99–235

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5b0o
Deposition date deposition_date	2015-11-02
Structure title title	Structure of the FliH-FliI complex
Keywords keywords	Bacterial flagellum, type III secretion, ATPase, peripheral stalk, HYDROLASE-MOTOR PROTEIN complex; HYDROLASE/MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5b0o__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5b0o__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5b0o__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.89 Å
Rg (electron density)	32.53 Å
Total Rg	32.91 Å
Atom count	5514
Residues	717
Excluded volume	97999 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5b0o__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5b0o__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5b0o__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5b0o__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellum-specific ATP synthase
Molecular weight formula_weight	49319.6 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	21982

MTTRLTRWLTALDNFEAKMALLPAVRRYGRLTRATGLVLEATGLQLPLGATCIIERQDGPETKEVESEVVGFNGQRLFLMPLEEVEGILPGARVYARNGHGDGLQSGKQLPLGPALLGRVLDGGGKPLDGLPAPDTLETGALITPPFNPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNGIHGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAGHYPAIDIEASISRAMTALITEQHYARVRLFKQLLSSFQRNRDLVSVGAYAKGSDPMLDKAITLWPQLEAFLQQGIFERADWEDSLQALDLIFPTV

Source Source

Source organism organism	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar assembly protein FliH
Molecular weight formula_weight	15335.4 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H,I,J,K,L

GSHAPIHARMQQLVSEFQNTLDALDSVIASRLMQMALEAARQVIGQTPAVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVEEMLGATLSLHGWRLRGDPTLHHGGCKVSADEGDLDASVATRWQELCRLAAPGVL

Source Source

Source organism organism	Salmonella typhimurium
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	133.662 Å
Unit-cell length b length_b	147.305 Å
Unit-cell length c length_c	164.233 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	51.315 Å
R factor r_factor	0.2203
R_work r_work	0.2177
R_free r_free	0.2703

Structure of the FliH-FliI complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellum-specific ATP synthase

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar assembly protein FliH

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5b0o__assembly_4__model_1

5b0o__assembly_4__model_1 | I(q)

5b0o__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (2)

Structure of the FliH-FliI complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellum-specific ATP synthase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar assembly protein FliH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5b0o__assembly_4__model_1

5b0o__assembly_4__model_1 | I(q)

5b0o__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (2)