SAXSdb — 5cqe

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Matrix protein 1

Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–164 Chain B； UniProt 1–164	Not recorded	CL CHLORIDE ION × 3 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 EDO 1,2-ETHANEDIOL × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5；295 K；Protein: 12.8 mg/mL 10 mM Tris-HCl pH 8.3 500 mM NaCl 0.5 mM TCEP Crsytallization: The JCSG+ Suite (B9: 100 mM Citric acid pH 4.0 20% (w/v) PEG 6000; final pH 5.0 Cryocondition: Crystallization condition + sucrose (50%)	Resolution 2.10 Å R-free 0.197

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5CQE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AA7 INFLUENZA VIRUS MATRIX PROTEIN CRYSTAL STRUCTURE AT PH 4.0 Deposited 1997-01-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–158（158 aa） Chain B 1–158（158 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4；20% PEG 3350, 50MM NAH2PO4, PH 4.0	Resolution 2.08 Å R-free 0.280
1EA3 Influenza virus M1 protein Deposited 2000-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–164（164 aa） Fragment：N-TERMINAL DOMAIN RESIDUES 1-164	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.1M HEPES PH7.5, 5% V/V ISOPROPANOL,6-10% PEG4000, pH 7.00	Resolution 2.30 Å R-free 0.313
1EA3 Influenza virus M1 protein Deposited 2000-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–164（164 aa） Fragment：N-TERMINAL DOMAIN RESIDUES 1-164	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.1M HEPES PH7.5, 5% V/V ISOPROPANOL,6-10% PEG4000, pH 7.00	Resolution 2.30 Å R-free 0.313
1HHI THE ANTIGENIC IDENTITY OF PEPTIDE(SLASH)MHC COMPLEXES: A COMPARISON OF THE CONFORMATION OF FIVE PEPTIDES PRESENTED BY HLA-A2 Deposited 1993-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 58–66（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1HHI THE ANTIGENIC IDENTITY OF PEPTIDE(SLASH)MHC COMPLEXES: A COMPARISON OF THE CONFORMATION OF FIVE PEPTIDES PRESENTED BY HLA-A2 Deposited 1993-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 58–66（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
3VDX Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains Deposited 2012-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–164（162 aa） Chain B 3–164（162 aa） Chain C 3–164（162 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；298 K；1.2M NaH2PO4, 0.8M K2HPO4, 0.1M CAPS, pH 10.3, vapor diffusion, hanging drop, temperature 298K	Resolution 3.00 Å R-free 0.281
4D9J Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–164（162 aa） Chain B 3–164（162 aa） Chain C 3–164（162 aa） Chain D 3–164（162 aa） Chain E 3–164（162 aa） Chain F 3–164（162 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；298 K；1.2M NaH2PO4, 0.8M K2HPO4, 0.1M CAPS, pH 10.3, vapor diffusion, hanging drop, temperature 298K	Resolution 3.92 Å R-free 0.294
4D9J Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain G 3–164（162 aa） Chain H 3–164（162 aa） Chain I 3–164（162 aa） Chain J 3–164（162 aa） Chain K 3–164（162 aa） Chain L 3–164（162 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；298 K；1.2M NaH2PO4, 0.8M K2HPO4, 0.1M CAPS, pH 10.3, vapor diffusion, hanging drop, temperature 298K	Resolution 3.92 Å R-free 0.294
4IQ4 Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form Deposited 2013-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–165（163 aa） Chain B 3–165（163 aa） Chain C 3–165（163 aa） Chain D 3–165（163 aa） Chain E 3–165（163 aa） Chain F 3–165（163 aa）	Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.4；298 K；0.1M Na Citrate pH 4.4, 10% PEG 3,000, vapor diffusion, hanging drop, temperature 298K	Resolution 3.50 Å R-free 0.231
4ITV Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form Deposited 2013-01-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–164（162 aa） Chain B 3–164（162 aa） Chain C 3–164（162 aa） Chain D 3–164（162 aa） Chain E 3–164（162 aa） Chain F 3–164（162 aa） Chain G 3–164（162 aa） Chain H 3–164（162 aa） Chain I 3–164（162 aa） Chain J 3–164（162 aa） Chain K 3–164（162 aa） Chain L 3–164（162 aa）	Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.4；298 K；0.1M Na Citrate pH 4.4, 10% PEG 3000, vapor diffusion, hanging drop, temperature 298K	Resolution 3.60 Å R-free 0.240
4IVJ Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form Deposited 2013-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–165（163 aa） Chain B 3–165（163 aa） Chain C 3–165（163 aa）	Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T Mutation：K118A, L279Q, Q24T	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.4；298 K；0.1M Na Citrate pH 4.4, 10% PEG 3000, vapor diffusion, hanging drop, temperature 298K	Resolution 7.35 Å R-free 0.288
4QES Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, quadruple mutant, I222 form Deposited 2014-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–164（162 aa） Fragment：SEE REMARK 999 Chain B 3–164（162 aa） Fragment：SEE REMARK 999 Chain C 3–164（162 aa） Fragment：SEE REMARK 999	Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.4；298 K；0.1 M sodium citrate, pH 4.4, 11% PEG3000, 200 mM sodium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.19 Å R-free 0.295
4QF0 Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, quadruple mutant, P21212 form Deposited 2014-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–164（162 aa） Fragment：SEE REMARK 999 Chain B 3–164（162 aa） Fragment：SEE REMARK 999 Chain C 3–164（162 aa） Fragment：SEE REMARK 999 Chain D 3–164（162 aa） Fragment：SEE REMARK 999 Chain E 3–164（162 aa） Fragment：SEE REMARK 999 Chain F 3–164（162 aa） Fragment：SEE REMARK 999	Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；0.1 M Tris, pH 7.0, 10% PEG8000, 0.2 M magnesium chloride, 3% trehalose, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 6.49 Å R-free 0.324
4QFF Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, quadruple mutant, P212121 form Deposited 2014-05-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 3–164（162 aa） Fragment：SEE REMARK 999 Chain B 3–164（162 aa） Fragment：SEE REMARK 999 Chain C 3–164（162 aa） Fragment：SEE REMARK 999 Chain D 3–164（162 aa） Fragment：SEE REMARK 999 Chain E 3–164（162 aa） Fragment：SEE REMARK 999 Chain F 3–164（162 aa） Fragment：SEE REMARK 999 Chain G 3–164（162 aa） Fragment：SEE REMARK 999 Chain H 3–164（162 aa） Fragment：SEE REMARK 999 Chain I 3–164（162 aa） Fragment：SEE REMARK 999 Chain J 3–164（162 aa） Fragment：SEE REMARK 999 Chain K 3–164（162 aa） Fragment：SEE REMARK 999 Chain L 3–164（162 aa） Fragment：SEE REMARK 999	Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A Mutation：K118A, L279Q, Q24T, Y51A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；298 K；0.1 M sodium/potassium phosphate, pH 5.8, 10% PEG8000, 0.2 M sodium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 7.81 Å R-free 0.339
5EUO PF6-M1-HLA-A2 Deposited 2015-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 58–66（9 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；PEG3350, Imidazole	Resolution 2.10 Å R-free 0.281
5EUO PF6-M1-HLA-A2 Deposited 2015-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain I 58–66（9 aa）	Not recorded	IMD IMIDAZOLE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；PEG3350, Imidazole	Resolution 2.10 Å R-free 0.281
6Z5L Helical reconstruction of influenza A virus M1 in complex with nucleic acid. Deposited 2020-05-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 80 PDB declaration: 80-meric	Chain A 1–252（252 aa）	Mutation：R134K	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 10 cryo-EM vitrification conditions Cryogen ETHANE；sample was applied 3 times each with 30s adsorption time	Resolution 3.80 Å

13 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	M1_I34A1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–188； UniProt 1–164 Author chain B； PDBConstruct 25–188； UniProt 1–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5cqe
Deposition date deposition_date	2015-07-21
Structure title title	2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from Influenza A virus (A/Puerto Rico/8/34(H1N1))
Keywords keywords	;matrix protein 1, Influenza A virus (A/Puerto Rico/8/34(H1N1)), CSGID, virulence, pathogenesis, Structural Genomics, Center for Structural Genomics of Infectious Diseases, VIRAL PROTEIN ;; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.39 Å
Radius of gyration Rg (electron density) rg_electron	20.67 Å
Forward intensity I(0) i0	20851000.00
Molecular weight molecular_weight	35369.0 kDa
Excluded volume excluded_volume	44620 Å³
Envelope volume envelope_volume	51468 Å³
Hydration-shell volume shell_volume	20955 Å³
Envelope diameter envelope_diameter	68.0 Å
Shell Rg shell_rg	27.01 Å
Envelope Rg envelope_rg	20.90 Å
Shape Rg shape_rg	20.70 Å
Total Rg total_rg	21.44 Å
Total atoms total_atoms	2473
Residues n_residues	319
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	67.2 Å
Rg (real space) rg_real	21.37 Å
Rg uncertainty (real space) rg_real_error	0.45 Å
I(0) (real space) i0_real	2.0850e+07
I(0) uncertainty (real space) i0_real_error	2.8900e+05
Rg (reciprocal space) rg_reciprocal	21.38 Å
I(0) (reciprocal space) i0_reciprocal	20850000.0000
Solution quality estimate total_estimate	0.8200
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	24.7 Å
Skewness Skewness skewness	0.350
Kurtosis Kurtosis kurtosis	-0.370
Angular range angular_range	— – 0.3700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	5846000.0000
Real-space data points n_real_points	69
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.890; Stabil: 0.996; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Matrix protein 1
Molecular weight formula_weight	20952.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2636

MHHHHHHSSGVDLGTENLYFQSNAMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQ

来源 Source

来源生物 organism	Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
NCBI Class编号 ncbi_taxonomy_id	211044
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Molecular weight formula_weight	122.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	90

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d5cqea1
Class class	a — All alpha proteins
Fold Fold fold	a.95 — Influenza virus matrix protein M1
Superfamily Superfamily superfamily	a.95.1 — Influenza virus matrix protein M1
Family Family family	a.95.1.1 — Influenza virus matrix protein M1

Domain ID domain_id	d5cqea2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5cqeb1
Class class	a — All alpha proteins
Fold Fold fold	a.95 — Influenza virus matrix protein M1
Superfamily Superfamily superfamily	a.95.1 — Influenza virus matrix protein M1
Family Family family	a.95.1.1 — Influenza virus matrix protein M1

Domain ID domain_id	d5cqeb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	5cqeA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	91 — Influenza Virus Matrix Protein; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Influenza matrix M1, N-terminal subdomain 1

Domain ID domain_id	5cqeA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	180 — Influenza matrix protein M1, N-terminal subdomain 2

Domain ID domain_id	5cqeB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	91 — Influenza Virus Matrix Protein; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Influenza matrix M1, N-terminal subdomain 1

Domain ID domain_id	5cqeB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	180 — Influenza matrix protein M1, N-terminal subdomain 2

▶

8. Citations (1)

▶

Unit-cell length a length_a	78.367 Å
Unit-cell length b length_b	117.896 Å
Unit-cell length c length_c	40.256 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	29.470 Å
R factor r_factor	0.1760
R_work r_work	0.1749
R_free r_free	0.1974

fit	/app/data/saxs_computation/cq/5cqe/5cqe.fit
pddf	/app/data/pr_computation/cq/5cqe/5cqe.pr.out
profile	/app/data/saxs_computation/cq/5cqe/5cqe.dat

2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from Influenza A virus (A/Puerto Rico/8/34(H1N1))