SAXSdb — 5ctd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain × 1 （P08123,Q14055） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CO1A1_HUMAN
Isoform	—
PDB entities	1, 3
Chains and sequence ranges	Author chain A； PDBConstruct 15–26； UniProt 572–583 Author chain C； PDBConstruct 15–26； UniProt 572–583

Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain

Homo sapiens

UniProt P20849

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain × 1 （P08123,Q14055） Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain × 1 （P02452,Q14050） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CO9A1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 36–71； UniProt 754–789

Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain

Homo sapiens

UniProt P08123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain × 1 （P02452,P20849） Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain × 1 （P02452,Q14050） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CO1A2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 15–26； UniProt 484–495

Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain

Homo sapiens

UniProt Q14055

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain × 1 （P02452,P20849） Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain × 1 （P02452,Q14050） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CO9A2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 36–71； UniProt 517–552

Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain

Homo sapiens

UniProt Q14050

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 3	Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain × 1 （P02452,P20849） Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain × 1 （P08123,Q14055） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CO9A3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 36–72； UniProt 517–553

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5ctd
Deposition date deposition_date	2015-07-23
Structure title title	Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest fragment a2a1a1 of type I collagen
Keywords keywords	collagen, hetero-trimerization, chain stagger, chain register, triple helix, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5ctd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5ctd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5ctd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.09 Å
Rg (electron density)	44.25 Å
Total Rg	43.06 Å
Atom count	2814
Residues	204
Excluded volume	25004 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5ctd__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain
Molecular weight formula_weight	7161.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3061

GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGAT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain
Molecular weight formula_weight	6895.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSGPPGPPGPPGPPGARGEPGNIGFPGPPGPPGPPGRDATDQHIVDVALKMLQEQLAEVAVSAKREALGAV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain
Molecular weight formula_weight	6999.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSI

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	194

▶

Unit-cell length a length_a	27.890 Å
Unit-cell length b length_b	55.920 Å
Unit-cell length c length_c	62.100 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.86 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.599 Å
Low-resolution limit resolution_low	41.532 Å
R factor r_factor	0.1791
R_work r_work	0.1771
R_free r_free	0.2025

Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest fragment a2a1a1 of type I collagen

1. Protein Identity and Related Structures Protein Identity & Related Structures

Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ctd__assembly_1__model_1

5ctd__assembly_1__model_1 | I(q)

5ctd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest fragment a2a1a1 of type I collagen

1. Protein Identity and Related Structures Protein Identity & Related Structures

Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ctd__assembly_1__model_1

5ctd__assembly_1__model_1 | I(q)

5ctd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)