5e69

Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex

Method: X-RAY DIFFRACTION D_max: 68.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glucocorticoid receptor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain A； UniProt 391–480 Chain B； UniProt 391–480	Fragment：unp residues 391-480	;DNA (5'-D(GPAPGPGPAPAPAPTPTPCPCPAPCPGPAPT)-3') ; × 1 ;DNA (5'-D(APTPCPGPTPGPGPAPAPTPTPTPCPCPTPC)-3') ; × 1 ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M HEPES pH 7.5, 7.5% glycerol, 22% PEG 20000	Resolution 1.85 Å R-free 0.242

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5E69	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1M2Z Crystal structure of a dimer complex of the human glucocorticoid receptor ligand-binding domain bound to dexamethasone and a TIF2 coactivator motif Deposited 2002-06-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 521–777（257 aa） Fragment：Ligand Binding Domain, residues 521-777 Chain D 521–777（257 aa） Fragment：Ligand Binding Domain, residues 521-777	Mutation：F602S Mutation：F602S	BOG octyl beta-D-glucopyranoside × 3 DEX DEXAMETHASONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；salts, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.267
1NHZ Crystal Structure of the Antagonist Form of Glucocorticoid Receptor Deposited 2002-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 500–777（278 aa） Fragment：residue 500-777, hinge and steroid binding domains	Mutation：N517D, F602S, C638D	486 11-(4-DIMETHYLAMINO-PHENYL)-17-HYDROXY-13-METHYL-17-PROP-1-YNYL-1,2,6,7,8,11,12,13,14,15,16,17-DODEC AHYDRO-CYCLOPENTA[A]PHENANTHREN-3-ONE × 1 HEZ HEXANE-1,6-DIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.2；288 K；PEG 8000, 1, 6-hexanediol, NaSCN, Tris-HCl, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.30 Å R-free 0.276
1NHZ Crystal Structure of the Antagonist Form of Glucocorticoid Receptor Deposited 2002-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：residue 500-777, hinge and steroid binding domains	Mutation：N517D, F602S, C638D	486 11-(4-DIMETHYLAMINO-PHENYL)-17-HYDROXY-13-METHYL-17-PROP-1-YNYL-1,2,6,7,8,11,12,13,14,15,16,17-DODEC AHYDRO-CYCLOPENTA[A]PHENANTHREN-3-ONE × 2 HEZ HEXANE-1,6-DIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.2；288 K；PEG 8000, 1, 6-hexanediol, NaSCN, Tris-HCl, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.30 Å R-free 0.276
1P93 CRYSTAL STRUCTURE OF THE AGONIST FORM OF GLUCOCORTICOID RECEPTOR Deposited 2003-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：RESIDUE 500-777, hinge and steroid binding domains	Mutation：N517D, F602S, C638D	DEX DEXAMETHASONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；281 K；PEG 400, MgCl2, Dioxane, Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.70 Å R-free 0.363
1P93 CRYSTAL STRUCTURE OF THE AGONIST FORM OF GLUCOCORTICOID RECEPTOR Deposited 2003-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 500–777（278 aa） Fragment：RESIDUE 500-777, hinge and steroid binding domains	Mutation：N517D, F602S, C638D	DEX DEXAMETHASONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；281 K；PEG 400, MgCl2, Dioxane, Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.70 Å R-free 0.363
1P93 CRYSTAL STRUCTURE OF THE AGONIST FORM OF GLUCOCORTICOID RECEPTOR Deposited 2003-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 500–777（278 aa） Fragment：RESIDUE 500-777, hinge and steroid binding domains	Mutation：N517D, F602S, C638D	DEX DEXAMETHASONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；281 K；PEG 400, MgCl2, Dioxane, Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.70 Å R-free 0.363
1P93 CRYSTAL STRUCTURE OF THE AGONIST FORM OF GLUCOCORTICOID RECEPTOR Deposited 2003-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 500–777（278 aa） Fragment：RESIDUE 500-777, hinge and steroid binding domains	Mutation：N517D, F602S, C638D	DEX DEXAMETHASONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；281 K；PEG 400, MgCl2, Dioxane, Tris, pH 8.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.70 Å R-free 0.363
3BQD Doubling the Size of the Glucocorticoid Receptor Ligand Binding Pocket by Deacylcortivazol Deposited 2007-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 525–777（253 aa） Fragment：glucocorticoid receptor ligand binding domain (residues 525-777)	Mutation：F602S	DAY 1-[(1R,2R,3aS,3bS,10aR,10bS,11S,12aS)-1,11-dihydroxy-2,5,10a,12a-tetramethyl-7-phenyl-1,2,3,3a,3b,7,10,10a,10b,11,12,12a-dodecahydrocyclopenta[5,6]naphtho[1,2-f]indazol-1-yl]-2-hydroxyethanone × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；1.3 M ammonium sulfate, 100 mM Tris, 8% glycerol, 3 mM n-hexadecyl-beta-maltoside, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.50 Å R-free 0.261
3CLD Ligand binding domain of the glucocorticoid receptor complexed with fluticazone furoate Deposited 2008-03-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 521–777（257 aa） Fragment：ligand binding domain, UNP residues 521-777 Chain B 521–777（257 aa） Fragment：ligand binding domain, UNP residues 521-777	Mutation：F602Y, C638G Mutation：F602Y, C638G	GW6 (6alpha,11alpha,14beta,16alpha,17alpha)-6,9-difluoro-17-{[(fluoromethyl)sulfanyl]carbonyl}-11-hydroxy-16-methyl-3-oxoan drosta-1,4-dien-17-yl furan-2-carboxylate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；100mM BisTrisPropane, 2.2M NaCl, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.84 Å R-free 0.267
3E7C Glucocorticoid Receptor LBD bound to GSK866 Deposited 2008-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 521–777（257 aa） Fragment：UNP RESIDUES 521-777 Chain B 521–777（257 aa） Fragment：UNP RESIDUES 521-777	Mutation：F602Y, C638G Mutation：F602Y, C638G	866 5-amino-N-[(2S)-2-({[(2,6-dichlorophenyl)carbonyl](ethyl)amino}methyl)-3,3,3-trifluoro-2-hydroxypropyl]-1-(4-fluorophenyl)-1H-pyrazole-4-carboxamide × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1M MES pH 6.5, 1.6M MgSO4, 0.1% betahexaglucoside, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.15 Å R-free 0.266
3E7C Glucocorticoid Receptor LBD bound to GSK866 Deposited 2008-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 521–777（257 aa） Fragment：UNP RESIDUES 521-777	Mutation：F602Y, C638G	866 5-amino-N-[(2S)-2-({[(2,6-dichlorophenyl)carbonyl](ethyl)amino}methyl)-3,3,3-trifluoro-2-hydroxypropyl]-1-(4-fluorophenyl)-1H-pyrazole-4-carboxamide × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1M MES pH 6.5, 1.6M MgSO4, 0.1% betahexaglucoside, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.15 Å R-free 0.266
3E7C Glucocorticoid Receptor LBD bound to GSK866 Deposited 2008-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 521–777（257 aa） Fragment：UNP RESIDUES 521-777	Mutation：F602Y, C638G	866 5-amino-N-[(2S)-2-({[(2,6-dichlorophenyl)carbonyl](ethyl)amino}methyl)-3,3,3-trifluoro-2-hydroxypropyl]-1-(4-fluorophenyl)-1H-pyrazole-4-carboxamide × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1M MES pH 6.5, 1.6M MgSO4, 0.1% betahexaglucoside, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.15 Å R-free 0.266
3H52 Crystal structure of the antagonist form of human glucocorticoid receptor Deposited 2009-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 528–777（250 aa） Fragment：Steroid-binding domain, UNP residues 528-777 Chain D 528–777（250 aa） Fragment：Steroid-binding domain, UNP residues 528-777	Mutation：F602S,C638D,W712S, E684A, E688A Mutation：F602S,C638D,W712S, E684A, E688A	486 11-(4-DIMETHYLAMINO-PHENYL)-17-HYDROXY-13-METHYL-17-PROP-1-YNYL-1,2,6,7,8,11,12,13,14,15,16,17-DODEC AHYDRO-CYCLOPENTA[A]PHENANTHREN-3-ONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；VAPOR DIFFUSION, SITTING DROP	Resolution 2.80 Å R-free 0.283
3H52 Crystal structure of the antagonist form of human glucocorticoid receptor Deposited 2009-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 528–777（250 aa） Fragment：Steroid-binding domain, UNP residues 528-777 Chain C 528–777（250 aa） Fragment：Steroid-binding domain, UNP residues 528-777	Mutation：F602S,C638D,W712S, E684A, E688A Mutation：F602S,C638D,W712S, E684A, E688A	486 11-(4-DIMETHYLAMINO-PHENYL)-17-HYDROXY-13-METHYL-17-PROP-1-YNYL-1,2,6,7,8,11,12,13,14,15,16,17-DODEC AHYDRO-CYCLOPENTA[A]PHENANTHREN-3-ONE × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；VAPOR DIFFUSION, SITTING DROP	Resolution 2.80 Å R-free 0.283
3K22 Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide Deposited 2009-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 521–777（257 aa）	Mutation：F602Y, C638G	JZS N-[(1R)-2-amino-1-methyl-2-oxoethyl]-3-(6-methyl-4-{[3,3,3-trifluoro-2-hydroxy-2-(trifluoromethyl)propyl]amino}-1H-indazol-1-yl)benzamide × 1 JZR hexyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.255
3K22 Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide Deposited 2009-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 521–777（257 aa）	Mutation：F602Y, C638G	JZS N-[(1R)-2-amino-1-methyl-2-oxoethyl]-3-(6-methyl-4-{[3,3,3-trifluoro-2-hydroxy-2-(trifluoromethyl)propyl]amino}-1H-indazol-1-yl)benzamide × 1 JZR hexyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å R-free 0.255
3K23 Glucocorticoid Receptor with Bound D-prolinamide 11 Deposited 2009-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 521–777（257 aa） Fragment：UNP residues 521-777, Ligand Binding Domain	Mutation：F602Y, C638G	JZN 1-{[3-(4-{[(2R)-4-(5-fluoro-2-methoxyphenyl)-2-hydroxy-4-methyl-2-(trifluoromethyl)pentyl]amino}-6-methyl-1H-indazol-1-yl)phenyl]carbonyl}-D-prolinamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1M MES 6.5, 28% PEG 5K MME, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.00 Å R-free 0.289
3K23 Glucocorticoid Receptor with Bound D-prolinamide 11 Deposited 2009-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 521–777（257 aa） Fragment：UNP residues 521-777, Ligand Binding Domain	Mutation：F602Y, C638G	JZN 1-{[3-(4-{[(2R)-4-(5-fluoro-2-methoxyphenyl)-2-hydroxy-4-methyl-2-(trifluoromethyl)pentyl]amino}-6-methyl-1H-indazol-1-yl)phenyl]carbonyl}-D-prolinamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1M MES 6.5, 28% PEG 5K MME, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.00 Å R-free 0.289
3K23 Glucocorticoid Receptor with Bound D-prolinamide 11 Deposited 2009-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 521–777（257 aa） Fragment：UNP residues 521-777, Ligand Binding Domain	Mutation：F602Y, C638G	JZN 1-{[3-(4-{[(2R)-4-(5-fluoro-2-methoxyphenyl)-2-hydroxy-4-methyl-2-(trifluoromethyl)pentyl]amino}-6-methyl-1H-indazol-1-yl)phenyl]carbonyl}-D-prolinamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1M MES 6.5, 28% PEG 5K MME, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.00 Å R-free 0.289
4CSJ The discovery of potent selective glucocorticoid receptor modulators, suitable for inhalation Deposited 2014-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：LIGAND BINDING DOMAIN, RESIDUES 500-777	Mutation：YES	EDO 1,2-ETHANEDIOL × 1 NN7 N-[(2S)-1-[[1-(4-fluorophenyl)indazol-4-yl]amino]propan-2-yl]-2,4,6-trimethyl-benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；10% PEG8000, 20% ETHYLENE GLYCOL AND 0.1 M HEPES PH7.5	Resolution 2.30 Å R-free 0.234
4HN5 GR DNA Binding Domain - TSLP nGRE Complex Deposited 2012-10-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 417–506（90 aa） Fragment：Glucocorticoid Receptor DNA Binding Domain Chain B 417–506（90 aa） Fragment：Glucocorticoid Receptor DNA Binding Domain	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；15 % PEG 20000, 6 % glycerol, 7.5 % ethanol, 0.1M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.235
4HN6 GR DNA Binding Domain R460D/D462R - TSLP nGRE Complex Deposited 2012-10-18	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 417–506（90 aa） Chain B 417–506（90 aa）	Mutation：R460D,D462R Mutation：R460D,D462R	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；15 % PEG 2000 MME, 6 % glycerol, 0.1M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.55 Å R-free 0.248
4LSJ Crystal Structure of the Glucocorticoid Receptor Ligand Binding Domain Bound to a Dibenzoxapine Sulfonamide Deposited 2013-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 522–777（256 aa） Fragment：Steroid-binding region, residues 522-777	Mutation：F602Y, C638G	LSJ N-{3-[(1Z)-1-(10-methoxydibenzo[b,e]oxepin-11(6H)-ylidene)propyl]phenyl}methanesulfonamide × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；294.15 K；0.1 M bis-tris propane pH 5.5, 0.3 M Magnesium Formate, VAPOR DIFFUSION, SITTING DROP, temperature 294.15K	Resolution 2.35 Å R-free 0.236
4LSJ Crystal Structure of the Glucocorticoid Receptor Ligand Binding Domain Bound to a Dibenzoxapine Sulfonamide Deposited 2013-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 522–777（256 aa） Fragment：Steroid-binding region, residues 522-777	Mutation：F602Y, C638G	LSJ N-{3-[(1Z)-1-(10-methoxydibenzo[b,e]oxepin-11(6H)-ylidene)propyl]phenyl}methanesulfonamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；294.15 K；0.1 M bis-tris propane pH 5.5, 0.3 M Magnesium Formate, VAPOR DIFFUSION, SITTING DROP, temperature 294.15K	Resolution 2.35 Å R-free 0.236
4MDD Crystal Structure of the Glucocorticoid Receptor Bound to a Non-steroidal Antagonist Reveals Repositioning and Partial Disordering of Activation Function Helix 12 Deposited 2013-08-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 522–777（256 aa） Fragment：unp residues 522-777 Chain B 522–777（256 aa） Fragment：unp residues 522-777	Mutation：L525S, L528S, L535A, V538T, F602Y, C638D, E684A, E688A, W712S Mutation：L525S, L528S, L535A, V538T, F602Y, C638D, E684A, E688A, W712S	29M N-[2-{[benzyl(methyl)amino]methyl}-3-(4-fluoro-2-methoxyphenyl)-5-(propan-2-yl)-1H-indol-7-yl]methanesulfonamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；294 K；100mM Tris HCl plus 6% 1,6 - Hexanediol + 24% PEG 8K, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 294K	Resolution 2.40 Å R-free 0.258
4P6W Crystal Structure of mometasone furoate-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 526–777（252 aa） Fragment：Ligand binding domain (UNP residues 526-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, K699A, K703A	MOF MOMETASONE FUROATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 1.95 Å R-free 0.225
4P6X Crystal Structure of cortisol-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 523–777（255 aa） Fragment：Ligand binding domain (UNP residues 523-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, E684A, E688A	HCY (11alpha,14beta)-11,17,21-trihydroxypregn-4-ene-3,20-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 2.50 Å R-free 0.276
4P6X Crystal Structure of cortisol-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 523–777（255 aa） Fragment：Ligand binding domain (UNP residues 523-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, E684A, E688A	HCY (11alpha,14beta)-11,17,21-trihydroxypregn-4-ene-3,20-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 2.50 Å R-free 0.276
4P6X Crystal Structure of cortisol-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 523–777（255 aa） Fragment：Ligand binding domain (UNP residues 523-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, E684A, E688A	HCY (11alpha,14beta)-11,17,21-trihydroxypregn-4-ene-3,20-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 2.50 Å R-free 0.276
4P6X Crystal Structure of cortisol-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 523–777（255 aa） Fragment：Ligand binding domain (UNP residues 523-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, E684A, E688A	HCY (11alpha,14beta)-11,17,21-trihydroxypregn-4-ene-3,20-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 2.50 Å R-free 0.276
4P6X Crystal Structure of cortisol-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 523–777（255 aa） Fragment：Ligand binding domain (UNP residues 523-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, E684A, E688A	HCY (11alpha,14beta)-11,17,21-trihydroxypregn-4-ene-3,20-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 2.50 Å R-free 0.276
4P6X Crystal Structure of cortisol-bound glucocorticoid receptor ligand binding domain Deposited 2014-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 523–777（255 aa） Fragment：Ligand binding domain (UNP residues 523-777)	Mutation：F602A, C622Y, T668V, S674T, V675I, E684A, E688A	HCY (11alpha,14beta)-11,17,21-trihydroxypregn-4-ene-3,20-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；0.1 M imidazole, pH6.5, and 1 M sodium acetate trihydrate. 30% sucrose	Resolution 2.50 Å R-free 0.276
4UDC GR in complex with dexamethasone Deposited 2014-12-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：LIGAND BINDING DOMAIN, UNP RESIDUES 500-777	Mutation：YES	CPS 3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE × 1 DEX DEXAMETHASONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；10% PEG8000, 10% ETHYLENE GLYCOL, 0.1 M HEPES PH 7.5	Resolution 2.50 Å R-free 0.253
4UDD GR in complex with desisobutyrylciclesonide Deposited 2014-12-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：LIGAND BINDING DOMAIN, UNP RESIDUES 500-777	Mutation：YES	CPS 3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE × 3 EDO 1,2-ETHANEDIOL × 1 CV7 DESISOBUYTYRYL CICLESONIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；10% PEG8000, 20% ETHYLENE GLYCOL, 0.1 M HEPES PH 7.5	Resolution 1.80 Å R-free 0.224
5CC1 S425G Glucocorticoid receptor DNA binding domain - (+)GRE complex Deposited 2015-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–480（90 aa） Chain B 391–480（90 aa）	Mutation：S425G Mutation：S425G	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1 M HEPES, 20% PEG 8000, and 4% ethylene glycol	Resolution 2.30 Å R-free 0.279
5CC1 S425G Glucocorticoid receptor DNA binding domain - (+)GRE complex Deposited 2015-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain W 391–480（90 aa） Chain X 391–480（90 aa）	Mutation：S425G Mutation：S425G	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.1 M HEPES, 20% PEG 8000, and 4% ethylene glycol	Resolution 2.30 Å R-free 0.279
5E6A Glucocorticoid receptor DNA binding domain - PLAU NF-kB response element complex Deposited 2015-10-09	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–480（90 aa） Fragment：unp residues 391-480 Chain B 391–480（90 aa） Fragment：unp residues 391-480	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.05 M sodium cacodylate, 0.05 M spermine, and 16% PEG 400	Resolution 2.20 Å R-free 0.266
5E6B Glucocorticoid receptor DNA binding domain - RELB NF-kB response element complex Deposited 2015-10-09	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–480（90 aa） Fragment：unp residues 391-480 Chain B 391–480（90 aa） Fragment：unp residues 391-480	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M HEPES pH 7.5, 7 uM spermine, 15% PEG 8000	Resolution 2.25 Å R-free 0.227
5E6C Glucocorticoid receptor DNA binding domain - CCL2 NF-kB response element complex Deposited 2015-10-09	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–480（90 aa） Fragment：unp residues 391-480 Chain B 391–480（90 aa） Fragment：unp residues 391-480	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M sodium malonate, 6% glycerol, 5% PEG 3350	Resolution 2.20 Å R-free 0.271
5E6D Glucocorticoid receptor DNA binding domain - ICAM1 NF-kB response element complex Deposited 2015-10-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–480（90 aa） Chain B 391–480（90 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M HEPES pH 7.7, 3% ethylene glycol, 10% PEG 8000	Resolution 2.40 Å R-free 0.283
5EMC Transcription factor GRDBD and smGRE complex Deposited 2015-11-06	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 411–500（90 aa） Fragment：UNP RESIDUES 411-500 Chain B 411–500（90 aa） Fragment：UNP RESIDUES 411-500	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；289 K；50mM HEPES, 100mM KCl, 10mM MgCl2, 5% PEG 400	Resolution 2.30 Å R-free 0.261
5EMP Transcription factor GRDBD and mmGRE complex Deposited 2015-11-06	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 411–500（90 aa） Fragment：UNP RESIDUES 411-500 Chain B 411–500（90 aa） Fragment：UNP RESIDUES 411-500	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；50mM Tris, 200mM KCl, 50mM MgCl2, 10% PEG 4000	Resolution 2.30 Å R-free 0.238
5EMQ Transcription factor GRDBD and GRE complex Deposited 2015-11-06	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 411–500（90 aa） Fragment：UNP RESIDUES 411-500 Chain B 411–500（90 aa） Fragment：UNP RESIDUES 411-500	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；50mM Na Cacodylate, 2.25mM Spermine, 18mM MgCl2, 9% isopropanol	Resolution 2.30 Å R-free 0.224
5G3J Discovery of New Selective Glucocorticoid Receptor Agonist Leads Deposited 2016-04-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：LIGAND BINDING DOMAIN, RESIDUES 500-777	Mutation：YES	CPS 3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE × 1 EDO 1,2-ETHANEDIOL × 1 E7T 5-[[(1S,2R,4R)-4-ethyl-6,7-bis(fluoranyl)-2,5-bis(oxidanyl)-2-(trifluoromethyl)-3,4-dihydro-1H-naphthalen-1-yl]amino]-1H-quinolin-2-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；8% PEG8000, 15% ETHYLENE GLYCOL AND 0.1 M HEPES PH 7.5	Resolution 2.40 Å R-free 0.235
5G5W Structure guided design and discovery of Indazole ethers as highly potent, non-steroidal Glucocorticoid receptor modulators Deposited 2016-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa） Fragment：LIGAND BINDING DOMAIN, UNP RESIDUES 500-777	Mutation：YES	EDO 1,2-ETHANEDIOL × 1 R8C 2,2,2-trifluoro-N-[(1R,2S)-1-{[1-(4-fluorophenyl)-1H-indazol-5-yl]oxy}-1-phenylpropan-2-yl]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；12% PEG8000, 20% ETHYLENE GLYCOL AND 0.1 M HEPES PH 7.5	Resolution 2.20 Å R-free 0.210
5NFP Glucocorticoid Receptor in complex with budesonide Deposited 2017-03-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa）	Not recorded	CPS 3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE × 1 EDO 1,2-ETHANEDIOL × 1 GOL GLYCEROL × 1 8W5 (1~{S},2~{S},4~{R},6~{R},8~{S},9~{S},11~{S},12~{S},13~{R})-9,13-dimethyl-11-oxidanyl-8-(2-oxidanylethanoyl)-6-propyl-5,7-dioxapentacyclo[10.8.0.0^{2,9}.0^{4,8}.0^{13,18}]icosa-14,17-dien-16-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；2 ul of protein, 0.2ul of Polypropylene Glycol 400 and 0.8ul of well solution (10-12% PEG8000, 20% ethylene glycol and 0.1 M Hepes pH 7.5).	Resolution 2.10 Å R-free 0.202
5NFT Glucocorticoid Receptor in complex with AZD5423 Deposited 2017-03-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 8W8 2,2,2-tris(fluoranyl)-~{N}-[(1~{R},2~{S})-1-[1-(4-fluorophenyl)indazol-5-yl]oxy-1-(3-methoxyphenyl)propan-2-yl]ethanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；2 ul of protein and 1ul of well solution (8-12% PEG8000, 10-20% ethylene glycol and 0.1 M Hepes pH 7.5)	Resolution 2.30 Å R-free 0.215
5UC3 Structure of the dominant negative mutant Glucocorticoid Receptor alpha (L733K/N734P) complexed with RU-486 Deposited 2016-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 522–777（256 aa） Fragment：UNP residues 522-777 Chain B 522–777（256 aa） Fragment：UNP residues 522-777	Mutation：L733K, N734P Mutation：L733K, N734P	486 11-(4-DIMETHYLAMINO-PHENYL)-17-HYDROXY-13-METHYL-17-PROP-1-YNYL-1,2,6,7,8,11,12,13,14,15,16,17-DODEC AHYDRO-CYCLOPENTA[A]PHENANTHREN-3-ONE × 4 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 6 EDO 1,2-ETHANEDIOL × 18 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M HEPES, 0.1 M sodium citrate, 15 % MPD (v/v)	Resolution 2.01 Å R-free 0.212
5VA0 Glucocorticoid Receptor DNA Binding Domain in complex with AP-1 response element from VCAM-1 Promoter Deposited 2017-03-24	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 84–155（72 aa） Fragment：unp residues 84-155 Chain B 84–155（72 aa） Fragment：unp residues 84-155	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.05 M Na Cacodylate (pH 7), 5 mM MgCl2, 1 mM Spermine, and 2 % t-Butanol	Resolution 2.29 Å R-free 0.231
5VA7 Glucocorticoid Receptor DNA Binding Domain - IL11 AP-1 recognition element Complex Deposited 2017-03-24	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 89–158（70 aa） Fragment：unp residues 89-158 Chain B 89–158（70 aa） Fragment：unp residues 89-158	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Lithium Nitratie, 15 % PEG 3350, 1 % glycerol	Resolution 2.15 Å R-free 0.227
6BQU Human GR (418-507) in complex with monomeric DNA binding site Deposited 2017-11-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 421–490（70 aa） Chain B 421–490（70 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.005 M Magnesium sulfate heptahydrate, 0.05 M MES monohydrate, pH 6.0, 5 percent w/v, Polyethylene glycol 4,000	Resolution 2.50 Å R-free 0.249
6BSF Human GR (418-507) in complex with monomeric DNA binding site Deposited 2017-12-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 419–505（87 aa） Chain B 419–505（87 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.05 M MES monohydrate pH 6.0 0.005 M Magnesium sulfate heptahydrate 5% w/v Polyethylene glycol 4,000	Resolution 2.40 Å R-free 0.233
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6CFN Crystal Structure of the DNA-free Glucocorticoid Receptor DNA Binding Domain Deposited 2018-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 418–506（89 aa）	Mutation：UNP Residues 418-506	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；291 K；25% PEG3350, 50 mM Tris pH8.5, and 200 mM di-sodium tartrate	Resolution 2.50 Å R-free 0.248
6DXK Glucocorticoid Receptor in complex with Compound 11 Deposited 2018-06-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 523–778（256 aa） Chain B 523–778（256 aa）	Not recorded	HJ4 (8S,11R,13S,14S,17S)-11-[4-(dimethylamino)phenyl]-17-(3,3-dimethylbut-1-yn-1-yl)-17-hydroxy-13-methyl-1,2,6,7,8,11,12,13,14,15,16,17-dodecahydro-3H-cyclopenta[a]phenanthren-3-one (non-preferred name) × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；pH 6.75	Resolution 3.05 Å R-free 0.260
6EL6 Glucocorticoid Receptor in complex with compound 4 Deposited 2017-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 B9Q ~{N}-[(1~{R},2~{S})-1-[1-(4-fluorophenyl)indazol-5-yl]oxy-1-(6-methoxypyridin-3-yl)propan-2-yl]cyclopropanecarboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；8-10% PEG8000, 10-19% Ethylene Glycol, 0.1 M HEPES pH 7.5	Resolution 2.40 Å R-free 0.283
6EL7 Glucocorticoid Receptor in complex with compound 31 Deposited 2017-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 B9T ~{N}-[(1~{R},2~{S})-1-(2-bromanyl-4-cyano-phenoxy)-1-(2-cyclopropylpyrimidin-5-yl)propan-2-yl]-2,2-bis(fluoranyl)propanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；8-10% PEG8000, 10-19% Ethylene Glycol, 0.1 M HEPES pH 7.5	Resolution 2.18 Å R-free 0.225
6EL9 Glucocorticoid Receptor in complex with AZD9567 Deposited 2017-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 500–777（278 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 B9W 2,2-bis(fluoranyl)-~{N}-[(1~{R},2~{S})-3-methyl-1-[1-(1-methyl-6-oxidanylidene-pyridin-3-yl)indazol-5-yl]oxy-1-phenyl-butan-2-yl]propanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；8-10% PEG8000, 10-19% Ethylene Glycol, 0.1 M HEPES pH 7.5	Resolution 2.19 Å R-free 0.224
6X6D Glucocorticoid Receptor DNA binding domain in complex with unmodified precursor for a modern recognition element (pre-GBS) Deposited 2020-05-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–464（74 aa） Chain B 391–464（74 aa）	Not recorded	ZN ZINC ION × 4 CAC CACODYLATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289.15 K；50 mM Sodium cacodylate pH 6.5, 80 mM Calcium chloride, 1 % glycerol, and 8.5% PEG 400	Resolution 2.48 Å R-free 0.211
6X6E Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a modern recognition element (methylated pre-GBS) Deposited 2020-05-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 391–465（75 aa） Chain B 391–465（75 aa）	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298.15 K；50 mM sodium cacodylate pH 6.5, 80 mM calcium chloride, 1 % glycerol, and 7 % PEG 400	Resolution 2.00 Å R-free 0.212
6YMO Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pS617 peptide Deposited 2020-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 611–623（13 aa） Chain D 611–623（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	SAL 2-HYDROXYBENZOIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.8；277.15 K；2.04 M ammonium sulfate, 0.2 M sodium citrate supplemented with 10% of an additive buffer containing 0.33% w/v 3-aminobenzoic acid, 0.33% w/v 3-aminosalicylic acid, 0.33% w/v salicylic acid and 0.02 M HEPES sodium pH 6.8	Resolution 2.02 Å R-free 0.234
6YO8 Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 518–530（13 aa） Chain F 518–530（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 8.3；277.15 K；1.29 M MgCl2, 22.5% PEG 3350, 0.1 M Tris pH 8.3, supplemented with 10% of an additive buffer containing 40% v/v of 2,5-Hexanediol	Resolution 2.09 Å R-free 0.238
6YO8 Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide Deposited 2020-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 518–530（13 aa） Chain H 518–530（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 8.3；277.15 K；1.29 M MgCl2, 22.5% PEG 3350, 0.1 M Tris pH 8.3, supplemented with 10% of an additive buffer containing 40% v/v of 2,5-Hexanediol	Resolution 2.09 Å R-free 0.238
6YOS Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 pS617 peptide Deposited 2020-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 518–530（13 aa） Chain C 611–623（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.8；293.15 K；0.35 M MgCl2, 24.4% PEG 3350, 0. 1 M Bis Tris pH 5.5 supplemented with 10% of an additive buffer containing 0.06 M CHAPS, 0.06 M HEPES, 0.06 M Tris, 0.25% w/v Hexamminecobalt(III) chloride and 0.02 M HEPES sodium pH 6.8.	Resolution 2.75 Å R-free 0.261
7KRJ The GR-Maturation Complex: Glucocorticoid Receptor in complex with Hsp90 and co-chaperone p23 Deposited 2020-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 520–777（258 aa）	Mutation：F602S	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2 DEX DEXAMETHASONE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.56 Å
7KW7 Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR Deposited 2020-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–777（777 aa）	Mutation：F602S	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.57 Å
7PRV The glucocorticoid receptor in complex with fluticasone furoate, a PGC1a coactivator fragment and sgk 23bp Deposited 2021-09-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 385–777（393 aa） Chain B 385–777（393 aa）	Mutation：S404A, N517D, V571M, F602S, C638D Mutation：S404A, N517D, V571M, F602S, C638D	ZN ZINC ION × 4 EDO 1,2-ETHANEDIOL × 3 GW6 (6alpha,11alpha,14beta,16alpha,17alpha)-6,9-difluoro-17-{[(fluoromethyl)sulfanyl]carbonyl}-11-hydroxy-16-methyl-3-oxoan drosta-1,4-dien-17-yl furan-2-carboxylate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；8 % PEG3350, 0.3 M 1,6-hexanediol, 0.1 M guanidine hydrochloride, 8 % 2,2,2-trifluoroethanol, 0.1 M Bis Tris Propane pH 6.5	Resolution 2.70 Å R-free 0.253
7PRW The glucocorticoid receptor in complex with velsecorat, a PGC1a coactivator fragment and sgk 23bp Deposited 2021-09-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 385–777（393 aa） Chain B 385–777（393 aa）	Mutation：S404A, N517D, V571M, F602S, C638D Mutation：S404A, N517D, V571M, F602S, C638D	ZN ZINC ION × 4 EDO 1,2-ETHANEDIOL × 6 82H Velsecorat × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；8.6 % PEG3350, 0.3 M 1,6-hexanediol, 0.1 M guanidine hydrochloride, 2 % 2,2,2-trifluoroethanol, 0.1 M BIS-TRIS propane pH 6.5	Resolution 2.50 Å R-free 0.263
7PRX wildtype ligand binding domain of the glucocorticoid receptor complexed with velsecorat and a PGC1a coactivator fragment Deposited 2021-09-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 529–777（249 aa）	Not recorded	82H Velsecorat × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；18 % PEG8000, 2 % 2-Propanol, 0.1 M Sodium acetate, 0.1 M HEPES pH 7.5	Resolution 2.20 Å R-free 0.281
8A9G Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by (R)-para chloropyrrolidone1 Deposited 2022-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 518–530（13 aa） Chain D 518–530（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	BTB 2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 2 QJK 5-[(2~{R})-3-(4-chlorophenyl)carbonyl-2-(4-nitrophenyl)-4-oxidanyl-5-oxidanylidene-2~{H}-pyrrol-1-yl]-2-oxidanyl-benzoic acid × 2 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277.15 K；0.4 M MgCl2 27% w/v PEG 3350 0.1 M Bis Tris 6.5 pH	Resolution 1.96 Å R-free 0.261
8FFV Cryo-EM structure of the GR-Hsp90-FKBP52 complex Deposited 2022-12-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 418–777（360 aa）	Mutation：F602S	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2 DEX DEXAMETHASONE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
8FFW Cryo-EM structure of the GR-Hsp90-FKBP51 complex Deposited 2022-12-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 418–777（360 aa）	Mutation：F602S	ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2 DEX DEXAMETHASONE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
8VKZ Crystal structure of Glucocorticoid Receptor in complex with an inhibitor Deposited 2024-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 528–777（250 aa） Chain B 528–777（250 aa）	Mutation：V571M, F602S, C638D Mutation：V571M, F602S, C638D	A1ACE (4aR,4bS,5R,6aS,6bS,8R,9aR,10aR,10bR)-8-{4-[(3-aminophenyl)methyl]phenyl}-5-hydroxy-6b-(hydroxyacetyl)-4a,6a-dimethyl-4a,4b,5,6,6a,6b,9a,10,10a,10b,11,12-dodecahydro-2H,8H-naphtho[2',1':4,5]indeno[1,2-d][1,3]dioxol-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；296 K；24% (w/v) PEG 400, 200 mM ammonium acetate, 100 mM sodium citrate pH 5.5	Resolution 2.13 Å R-free 0.245

54 other PDB entries and 79 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GCR_HUMAN
Isoform	P04150-8
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–114； UniProt 391–480 Author chain B； PDBConstruct 25–114； UniProt 391–480

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5e69
Deposition date deposition_date	2015-10-09
Structure title title	Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex
Keywords keywords	DNA binding proteins, dna binding protein-dna complex; dna binding protein/dna
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.88 Å
Radius of gyration Rg (electron density) rg_electron	19.47 Å
Forward intensity I(0) i0	20044000.00
Molecular weight molecular_weight	26290.0 kDa
Excluded volume excluded_volume	29534 Å³
Envelope volume envelope_volume	37855 Å³
Hydration-shell volume shell_volume	17004 Å³
Envelope diameter envelope_diameter	69.0 Å
Shell Rg shell_rg	24.89 Å
Envelope Rg envelope_rg	19.61 Å
Shape Rg shape_rg	19.47 Å
Total Rg total_rg	20.08 Å
Total atoms total_atoms	1774
Residues n_residues	178
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	68.8 Å
Rg (real space) rg_real	19.93 Å
Rg uncertainty (real space) rg_real_error	0.55 Å
I(0) (real space) i0_real	2.0040e+07
I(0) uncertainty (real space) i0_real_error	2.8570e+05
Rg (reciprocal space) rg_reciprocal	19.92 Å
I(0) (reciprocal space) i0_reciprocal	20040000.0000
Solution quality estimate total_estimate	0.8617
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.3 Å
Skewness Skewness skewness	0.426
Kurtosis Kurtosis kurtosis	-0.184
Angular range angular_range	— – 0.4000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1926000.0000
Real-space data points n_real_points	72
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.789; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.903; Smooth: 0.928

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Glucocorticoid receptor
Molecular weight formula_weight	12759.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1870

MHHHHHHSSGVDLGTENLYFQSNAPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(GPAPGPGPAPAPAPTPTPCPCPAPCPGPAPT)-3') ;
Molecular weight formula_weight	4931.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

GAGGAAATTCCACGAT

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(APTPCPGPTPGPGPAPAPTPTPTPCPCPTPC)-3') ;
Molecular weight formula_weight	4864.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

ATCGTGGAATTTCCTC

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	96

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	5e69A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	50 — Erythroid Transcription Factor GATA-1; Chain A
Homologous superfamily homologous superfamily	10 — Erythroid Transcription Factor GATA-1, subunit A

Domain ID domain_id	5e69B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	50 — Erythroid Transcription Factor GATA-1; Chain A
Homologous superfamily homologous superfamily	10 — Erythroid Transcription Factor GATA-1, subunit A

▶

8. Citations (1)

▶

Unit-cell length a length_a	39.165 Å
Unit-cell length b length_b	97.176 Å
Unit-cell length c length_c	103.265 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	34.267 Å
R factor r_factor	0.2212
R_work r_work	0.2197
R_free r_free	0.2418

fit	/app/data/saxs_computation/e6/5e69/5e69.fit
pddf	/app/data/pr_computation/e6/5e69/5e69.pr.out
profile	/app/data/saxs_computation/e6/5e69/5e69.dat

Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glucocorticoid receptor

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)