SAXSdb — 5ft1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GP37

PSEUDOMONAS PHAGE PHIKZ

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	RIBONUCLEASE E × 2 （Q9HZM8） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	RIBONUCLEASE E × 2 （Q9HZM8）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	RIBONUCLEASE E × 2 （Q9HZM8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8SDC5_BPDPK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–273； UniProt 1–273 Author chain B； PDBConstruct 1–273； UniProt 1–273 Author chain E； PDBConstruct 1–273； UniProt 1–273 Author chain G； PDBConstruct 1–273； UniProt 1–273 Author chain I； PDBConstruct 1–273； UniProt 1–273 Author chain K； PDBConstruct 1–273； UniProt 1–273

RIBONUCLEASE E

OrganismNot specified

UniProt Q9HZM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	GP37 × 2 （Q8SDC5） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	GP37 × 2 （Q8SDC5）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	GP37 × 2 （Q8SDC5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HZM8_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–20； UniProt 756–775 Author chain D； PDBConstruct 1–20； UniProt 756–775 Author chain F； PDBConstruct 1–20； UniProt 756–775 Author chain H； PDBConstruct 1–20； UniProt 756–775 Author chain J； PDBConstruct 1–20； UniProt 756–775 Author chain L； PDBConstruct 1–20； UniProt 756–775

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5ft1
Deposition date deposition_date	2016-01-08
Structure title title	Crystal structure of gp37(Dip) from bacteriophage phiKZ bound to RNase E of Pseudomonas aeruginosa
Keywords keywords	HYDROLASE-INHIBITOR COMPLEX, DIP, PHIKZ, BACTERIOPHAGE, RNASE E, RIBONUCLEASE INHIBITOR, RNA DEGRADOSOME, PSEUDOMONAS AERUGINOSA; HYDROLASE/INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5ft1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5ft1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5ft1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.23 Å
Rg (electron density)	28.35 Å
Total Rg	29.16 Å
Atom count	3838
Residues	510
Excluded volume	67653 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5ft1__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5ft1__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5ft1__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	GP37
Molecular weight formula_weight	31991.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,G,I,K
Atom count atom_count	11561

MTQFNITWEEQLQALSKLDGLHHPHKLEDISVHWVFNPVDISVFVTCATMSSHNTHYTFKPQSSPDDAMVREYVLSRIIADNLKYVDNLYLAAGAVICGNDEYISDGNVVGIHIADGVGGNKLILPVIEFMPGVHVDDISDKLIKSSSYQGIFKTDNLEEFEFLVDKKNANNVKELILAYTDYFANKLAFKDPAEPAVEMYQFIDRTEVYFSFEGCHPDVEEVLFTIKIVRYNQPLNSTAMQVFLKNPLLSHIRTVVRQDLPAKFVGGVLFNFKGHHHHHH

Source Source

Source organism organism	PSEUDOMONAS PHAGE PHIKZ
NCBI taxonomy ID ncbi_taxonomy_id	169683
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	RIBONUCLEASE E
Molecular weight formula_weight	2704.1 kDa
EC 编号 ec_number	3.1.26.12
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,F,H,J,L

ERPRRRSRGQRRRSNRRERQ

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▶

Unit-cell length a length_a	84.610 Å
Unit-cell length b length_b	84.650 Å
Unit-cell length c length_c	84.600 Å
Unit-cell angle α angle_alpha	107.86 °
Unit-cell angle β angle_beta	107.88 °
Unit-cell angle γ angle_gamma	107.90 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	72.188 Å
R factor r_factor	0.2660
R_work r_work	0.2629
R_free r_free	0.2934

Crystal structure of gp37(Dip) from bacteriophage phiKZ bound to RNase E of Pseudomonas aeruginosa

1. Protein Identity and Related Structures Protein Identity & Related Structures

GP37

State in the Current Structure

Other States of the Same Protein in the Database

RIBONUCLEASE E

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ft1__assembly_1__model_1

5ft1__assembly_1__model_1 | I(q)

5ft1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of gp37(Dip) from bacteriophage phiKZ bound to RNase E of Pseudomonas aeruginosa

1. Protein Identity and Related Structures Protein Identity & Related Structures

GP37

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RIBONUCLEASE E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ft1__assembly_1__model_1

5ft1__assembly_1__model_1 | I(q)

5ft1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)