SAXSdb — 5jp2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Epidermal growth factor receptor substrate 15

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	F-BAR domain only protein 1 × 1 （A0A0R4IJ14） ZINC ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	F-BAR domain only protein 1 × 1 （A0A0R4IJ14） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EPS15_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–23； UniProt 615–637 Author chain F； PDBConstruct 1–23； UniProt 615–637

F-BAR domain only protein 1

Danio rerio

UniProt A0A0R4IJ14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Epidermal growth factor receptor substrate 15 × 1 （P42566） ZINC ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Epidermal growth factor receptor substrate 15 × 1 （P42566） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0R4IJ14_DANRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–286； UniProt 615–900 Author chain B； PDBConstruct 1–286； UniProt 615–900

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5jp2
Deposition date deposition_date	2016-05-03
Structure title title	Fcho1 Mu homology domain (Danio Rerio) with bound Eps15 peptide
Keywords keywords	FCHO Eps15 Mu homology domain Endocytosis, Signaling protein; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5jp2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5jp2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5jp2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.49 Å
Rg (electron density)	23.62 Å
Total Rg	24.32 Å
Atom count	2229
Residues	290
Excluded volume	39468 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5jp2__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5jp2__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Epidermal growth factor receptor substrate 15
Molecular weight formula_weight	2850.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F
Atom count atom_count	4596

TNLDFFQSDPFVGSDPFKDDPFGGAGA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	F-BAR domain only protein 1
Molecular weight formula_weight	31229.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

GLSRGPSPISLSAQESWPVAAAITEYINAYFRGGEHNRCLVKITGDLTMSFPAGITRIFTANPNAPVLSFRLVNISRVDHFLPNQKLLYSDPSQSDPDTKDFWFNMQALTLHLQREAELNPQASYYNVALLKYQASSQDPSRAPLLLSAECQRSGTVTRVSLDYHCCPATAPATQLTSVQVLLPLDHSATDLQCQPPAAWNAEERRLLWKLANLSPTNHSKGSGTLCASWQCLEVPRGPAPSLAVQFVGSGASLSGLDVELVGSRYRMSLVKKRFATGKYMAGCSL

Source Source

Source organism organism	Danio rerio
Common name common_name	Zebrafish
NCBI taxonomy ID ncbi_taxonomy_id	7955
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	40

▶

Unit-cell length a length_a	239.778 Å
Unit-cell length b length_b	239.778 Å
Unit-cell length c length_c	44.091 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	45.314 Å
R factor r_factor	0.2010
R_work r_work	0.1992
R_free r_free	0.2343

Fcho1 Mu homology domain (Danio Rerio) with bound Eps15 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Epidermal growth factor receptor substrate 15

State in the Current Structure

Other States of the Same Protein in the Database

F-BAR domain only protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5jp2__assembly_1__model_1

5jp2__assembly_1__model_1 | I(q)

5jp2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Fcho1 Mu homology domain (Danio Rerio) with bound Eps15 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Epidermal growth factor receptor substrate 15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-BAR domain only protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5jp2__assembly_1__model_1

5jp2__assembly_1__model_1 | I(q)

5jp2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)