SAXSdb — 5mb9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative heat shock protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Putative ribosome associated protein × 1 （G0RYD6） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Putative ribosome associated protein × 1 （G0RYD6） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 GLYCEROL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZX9_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–590； UniProt 1–578 Author chain B； PDBConstruct 13–590； UniProt 1–578

Putative ribosome associated protein

Chaetomium thermophilum

UniProt G0RYD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Putative heat shock protein × 1 （G0RZX9） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Putative heat shock protein × 1 （G0RZX9） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 1 GLYCEROL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYD6_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 4–45； UniProt 19–60 Author chain D； PDBConstruct 4–45； UniProt 19–60

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5mb9
Deposition date deposition_date	2016-11-07
Structure title title	Crystal structure of the eukaryotic ribosome associated complex (RAC), a unique Hsp70/Hsp40 pair
Keywords keywords	Hsp70, Hsp40, chaperone; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5mb9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5mb9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5mb9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.02 Å
Rg (electron density)	26.68 Å
Total Rg	27.41 Å
Atom count	4153
Residues	540
Excluded volume	73684 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5mb9__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5mb9__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Putative heat shock protein
Molecular weight formula_weight	63838.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	8185

SAMGWSHPQFEKMAESASKAAPGERVVIGITFGNSNSSIAHTVDDKAEVIANEDGDRQIPTILSYVDGDEYYGQQAKNFLVRNPKNTVAYFRDILGQDFKSVDPTHNHASAHPQEAGDNVVFTIKDKAEEDAEPSTLTVSEIATRYLRRLVGAASEYLGKKVTSAVITIPTNFTEKQKAALIAAAAAADLEVLQLISEPAAAVLAYDARPEATISDKIIVVADLGGSRSDVTVLASRSGMYTILATVHDYEYHGIALDKVLIDHFSKEFLKKNPGAKDPRENPRSLAKLRLEAESTKRALSRSTNASFSVESLIDGLDFASTINRLRYETIARTVFEGFNRLVESAVKKAGLDPLDVDEVIMSGGTSNTPRIAANFRYIFPESTRILAPSTDPSALNPSELQARGAALQASLIQEFETEDIEQSTHAAVTTMPHVTNAIGVVSVSESGEEKFVPIIAPETAVPARRTVHLDAPKEGGDVLVKVVEGSTHINVIKPEPKAKEDGETKEKTEDADDDGDFDDDDEEEEEEEEEEEKREKVWKIGSTLAEAAVRGVKKGAKVEVTINVNTDLTVIVTAREVGGKGGVRGTLSA

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Putative ribosome associated protein
Molecular weight formula_weight	5062.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GAMAEKDFKAIGKLTQEGSSMRTLEPVGPHFLAHARRVRHKRTFS

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	8

▶

Unit-cell length a length_a	93.918 Å
Unit-cell length b length_b	179.359 Å
Unit-cell length c length_c	155.455 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	47.973 Å
R factor r_factor	0.2301
R_work r_work	0.2273
R_free r_free	0.2849

Crystal structure of the eukaryotic ribosome associated complex (RAC), a unique Hsp70/Hsp40 pair

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative heat shock protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative ribosome associated protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5mb9__assembly_1__model_1

5mb9__assembly_1__model_1 | I(q)

5mb9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Crystal structure of the eukaryotic ribosome associated complex (RAC), a unique Hsp70/Hsp40 pair

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative heat shock protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative ribosome associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5mb9__assembly_1__model_1

5mb9__assembly_1__model_1 | I(q)

5mb9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)