5mwh

Crystal structure of the human BRPF1 bromodomain in complex with BZ089

Method: X-RAY DIFFRACTION D_max: 67.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peregrin

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 626–740	Not recorded	UWX ~{N}-[1,4-dimethyl-7-morpholin-4-yl-2,3-bis(oxidanylidene)quinoxalin-6-yl]-4-(2-methylpropyl)benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.226
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 626–740	Not recorded	UWX ~{N}-[1,4-dimethyl-7-morpholin-4-yl-2,3-bis(oxidanylidene)quinoxalin-6-yl]-4-(2-methylpropyl)benzenesulfonamide × 1 NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.226

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5MWH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2RS9 Solution structure of the bromodomain of human BRPF1 in complex with histone H4K5ac peptide Deposited 2011-12-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 633–740（108 aa） Fragment：Bromodomain, UNP residues 633-740	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；288 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 1.5 mM H4K5ac-1, 0.54 mM [U-99% 13C; U-99% 15N] Bromodomain-2, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2X35 Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-01-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；20% PEG 3350, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 10 MM NACL	Resolution 2.00 Å R-free 0.236
2X4W Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1076–1205（130 aa） Fragment：RESIDUES 1076-1205	Not recorded	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；4M SODIUM FORMATE, 0.1M TRIS (PH 8.5), 0.01M NACL	Resolution 1.50 Å R-free 0.216
2X4X Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；20% PEG3350, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5) 0.01M NACL	Resolution 1.85 Å R-free 0.239
2X4X Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；20% PEG3350, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5) 0.01M NACL	Resolution 1.85 Å R-free 0.239
2X4X Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；20% PEG3350, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5) 0.01M NACL	Resolution 1.85 Å R-free 0.239
2X4X Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；20% PEG3350, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5) 0.01M NACL	Resolution 1.85 Å R-free 0.239
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
2X4Y Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1. Deposited 2010-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1076–1205（130 aa） Fragment：BRPF1 PWWP DOMAIN, RESIDUES 1076-1205	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% PEG4K, 0.2M LITHIUM SULPHATE, 0.1M TRIS (PH 8.5), 0.01M NACL.	Resolution 1.70 Å R-free 0.227
3L42 PWWP domain of human bromodomain and PHD finger containing protein 1 Deposited 2009-12-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1079–1207（129 aa） Fragment：UNP residues 1079-1207	Not recorded	UNX UNKNOWN LIGAND × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；291 K；3.5M sodium formate, 0.1M TRIS-hydrochloride, pH 8.5, vapor diffusion, temperature 291K X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；291 K；25% PEG3350, 0.1M ammonium sulfate, 0.1M HEPES, pH 7.5, vapor diffusion, temperature 291K	Resolution 1.30 Å R-free 0.233
3MO8 PWWP Domain of Human Bromodomain and PHD finger-containing protein 1 In Complex with Trimethylated H3K36 Peptide Deposited 2010-04-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1079–1207（129 aa） Fragment：UNP residues 1079-1207	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；3.5M sodium formate, 0.1M Tris-HCl pH8.5, H3K36me3 peptide, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.69 Å R-free 0.207
4LC2 Crystal structure of the bromodomain of human BRPF1B Deposited 2013-06-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：unp residues 626-740	Not recorded	NO3 NITRATE ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；20% PEG3350 0.1 M bis tris propane, 10% ethylene glycol 0.15 M sodium nitrate, pH 7.8, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.65 Å R-free 0.220
4QYD Crystal Structure of the human BRPF1 bromodomain in complex with a histone H4K12ac peptide Deposited 2014-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 629–742（114 aa） Fragment：bromodomain (UNP residues 629-742)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；277 K；0.1 M HEPES, pH 7.5, 10% w/v polyethylene glycol (PEG) 6,000, 5% v/v (+/-)-2-methyl-2,4-pentanediol (MPD), VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.94 Å R-free 0.213
4QYL Crystal Structure of the human BRPF1 bromodomain in complex with a histone H2AK5ac peptide Deposited 2014-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 629–742（114 aa） Fragment：bromodomain (UNP residues 629-742)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.2 M NH4SO4, 0.1 M MES monohydrate, pH 6.5, 30% w/v polyethylene glycol monomethyl ether (PEG) 5000, 1% propylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.80 Å R-free 0.253
4QYL Crystal Structure of the human BRPF1 bromodomain in complex with a histone H2AK5ac peptide Deposited 2014-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 629–742（114 aa） Fragment：bromodomain (UNP residues 629-742)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.2 M NH4SO4, 0.1 M MES monohydrate, pH 6.5, 30% w/v polyethylene glycol monomethyl ether (PEG) 5000, 1% propylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.80 Å R-free 0.253
4QYL Crystal Structure of the human BRPF1 bromodomain in complex with a histone H2AK5ac peptide Deposited 2014-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 629–742（114 aa） Fragment：bromodomain (UNP residues 629-742)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.2 M NH4SO4, 0.1 M MES monohydrate, pH 6.5, 30% w/v polyethylene glycol monomethyl ether (PEG) 5000, 1% propylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.80 Å R-free 0.253
4QYL Crystal Structure of the human BRPF1 bromodomain in complex with a histone H2AK5ac peptide Deposited 2014-07-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 629–742（114 aa） Fragment：bromodomain (UNP residues 629-742)	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.2 M NH4SO4, 0.1 M MES monohydrate, pH 6.5, 30% w/v polyethylene glycol monomethyl ether (PEG) 5000, 1% propylene glycol, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.80 Å R-free 0.253
4UYE BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-2-oxo-6-(piperidin-1- yl)-2,3-dihydro-1H-1,3-benzodiazol-5-yl-2-methoxybenzamide Deposited 2014-08-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 622–738（117 aa） Fragment：BROMODOMAIN, UNP RESIDUES 622-738	Not recorded	EDO 1,2-ETHANEDIOL × 1 9F9 N-[1,3-dimethyl-2-oxo-6-(piperidin-1-yl)-2,3-dihydro-1H-benzimidazol-5-yl]-2-methoxybenzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES/IMIDAZOLE PH 6.5, 10% MORPHEUS DIVALENTS MPD_P1K_P3350	Resolution 1.65 Å R-free 0.201
4UYE BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-2-oxo-6-(piperidin-1- yl)-2,3-dihydro-1H-1,3-benzodiazol-5-yl-2-methoxybenzamide Deposited 2014-08-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 622–738（117 aa） Fragment：BROMODOMAIN, UNP RESIDUES 622-738	Not recorded	9F9 N-[1,3-dimethyl-2-oxo-6-(piperidin-1-yl)-2,3-dihydro-1H-benzimidazol-5-yl]-2-methoxybenzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES/IMIDAZOLE PH 6.5, 10% MORPHEUS DIVALENTS MPD_P1K_P3350	Resolution 1.65 Å R-free 0.201
5C6S Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a Deposited 2015-06-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1079–1207（129 aa） Fragment：PWWP domain (UNP residues 1079-1207)	Not recorded	4K8 isoquinoline-3-carboxylic acid × 1 CL CHLORIDE ION × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 UNX UNKNOWN LIGAND × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；25% PEG 3350, 0.2M LiSO4, 0.1M HEPES pH7.5	Resolution 1.30 Å R-free 0.217
5C7N Crystal structure of the human BRPF1 bromodomain in complex with Bromosporine Deposited 2015-06-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：residues 626-740	Not recorded	BMF Bromosporine × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；20% PEG3350, 0.1 M sodium acetate, 0.15 M sodium nitrate, pH 5.5	Resolution 1.75 Å R-free 0.221
5C85 Crystal structure of the human BRPF1 bromodomain in complex with SEED1 Deposited 2015-06-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	NO3 NITRATE ION × 1 4YO 6-bromo-3,4-dihydroquinoxalin-2(1H)-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris propane, pH6.5, 0.2 M sodium nitrate, 20%PEG33500	Resolution 1.70 Å R-free 0.226
5C87 Crystal structure of the human BRPF1 bromodomain in complex with SEED2 Deposited 2015-06-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：residues 626-740	Not recorded	NO3 NITRATE ION × 1 4YS isoquinolin-1(2H)-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris propane, pH6.5, 0.2 M sodium nitrate, 20%PEG33500	Resolution 1.55 Å R-free 0.198
5C89 Crystal structure of the human BRPF1 bromodomain in complex with 917 Deposited 2015-06-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 627–740（114 aa）	Not recorded	4YT 1-ethyl-8-methoxy-5-methyl[1,2,4]triazolo[4,3-a]quinoline × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M sodium acetate, pH 5.5, 0.15 M potassium thiocynate, 20% PEG3350	Resolution 1.65 Å R-free 0.200
5D7X Crystal structure of the human BRPF1 bromodomain in complex with XZ08 Deposited 2015-08-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	NO3 NITRATE ION × 1 XZ8 4-(1-acetyl-1H-indol-3-yl)-5-methyl-1,2-dihydro-3H-pyrazol-3-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；0.1 M Bis-Tris Propane, pH6.5, 0.2M Sodium Nitrate, 20% PEG3350	Resolution 1.35 Å R-free 0.176
5DY7 Crystal structure of the human BRPF1 bromodomain in complex with SEED4 Deposited 2015-09-24	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	5GT 7-(trifluoromethyl)-3,4-dihydroquinoxalin-2(1H)-one × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.69 Å R-free 0.204
5DYA Crystal structure of the human BRPF1 bromodomain in complex with SEED5 Deposited 2015-09-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 625–740（116 aa） Fragment：UNP residues 625-740	Not recorded	NO3 NITRATE ION × 1 5GV (2R)-2-ethyl-3-oxo-1,2,3,4-tetrahydroquinoxaline-6-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.214
5DYC Crystal structure of the human BRPF1 bromodomain in complex with SEED6 Deposited 2015-09-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 625–740（116 aa） Fragment：UNP residues 625-740	Not recorded	NO3 NITRATE ION × 1 5GU 7-bromo-3,4-dihydroquinoxalin-2(1H)-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.235
5E3D Crystal structure of the human BRPF1 bromodomain in complex with SEED7 Deposited 2015-10-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5JL 2,8-dithioxo-1,2,3,7,8,9-hexahydro-6H-purin-6-one × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；0.1 M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.71 Å R-free 0.222
5E3G Crystal structure of the human BRPF1 bromodomain in complex with SEED8 Deposited 2015-10-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5JQ 2-thioxo-2,3,7,9-tetrahydro-1H-purine-6,8-dione × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Sodium Acetate, pH 5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.205
5EM3 Crystal structure of the human BRPF1 bromodomain in complex with SEED9 Deposited 2015-11-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5Q0 quinolin-5-ol × 2 NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Sodium-Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.40 Å R-free 0.188
5EPR Crystal structure of the human BRPF1 bromodomain in complex with SEED11 Deposited 2015-11-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5QY (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.220
5EPS Crystal structure of the human BRPF1 bromodomain in complex with SEED10 Deposited 2015-11-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 627–740（114 aa） Fragment：UNP residues 625-740	Not recorded	5QX 1-methyl-3,4-dihydroquinoxalin-2-one × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；0.1 M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.47 Å R-free 0.198
5EQ1 Crystal structure of the human BRPF1 bromodomain in complex with SEED12 Deposited 2015-11-12	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	BEA 5-METHYL-1,2,4-TRIAZOLO[3,4-B]BENZOTHIAZOLE × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.55 Å R-free 0.194
5ERC X-ray crystal structure of BRPF1 PZP domain Deposited 2015-11-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 274–450（177 aa） Fragment：PZP domain (UNP residues 274-450)	Not recorded	ZN ZINC ION × 5 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；0.2 M Calcium acetate, 0.1 M Imidazole pH 8.0, 10% PEG8000	Resolution 2.05 Å R-free 0.193
5ETB Crystal structure of the human BRPF1 bromodomain in complex with SEED13 Deposited 2015-11-17	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5RO 1-(7-methyl-1~{H}-indol-3-yl)ethanone × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.33 Å R-free 0.187
5ETD Crystal structure of the human BRPF1 bromodomain in complex with SEED14 Deposited 2015-11-17	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5RN 1-(1~{H}-indol-3-yl)ethanone × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.40 Å R-free 0.187
5EV9 Crystal structure of the human BRPF1 bromodomain in complex with SEED15 Deposited 2015-11-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5SB ~{N}-[5-(1~{H}-pyrazol-4-yl)quinolin-8-yl]ethanamide × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.45 Å R-free 0.221
5EVA Crystal structure of the human BRPF1 bromodomain in complex with SEED16 Deposited 2015-11-19	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5S9 ~{N}-[2,4-bis(fluoranyl)phenyl]-2-methyl-pyrazole-3-carboxamide × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.45 Å R-free 0.198
5EWC Crystal structure of the human BRPF1 bromodomain in complex with SEED17 Deposited 2015-11-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5SJ ethyl (2~{R})-2-methyl-3-oxidanylidene-2,4-dihydro-1~{H}-quinoxaline-6-carboxylate × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.75 Å R-free 0.211
5EWD Crystal structure of the human BRPF1 bromodomain in complex with SEED18 Deposited 2015-11-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5SH 4-phenylpyridine × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.58 Å R-free 0.226
5EWH Crystal structure of the human BRPF1 bromodomain in complex with SEED19 Deposited 2015-11-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5SG isoquinolin-5-ol × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.63 Å R-free 0.213
5EWV Crystal structure of the human BRPF1 bromodomain in complex with SEED20 Deposited 2015-11-21	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5SN 1,5-dimethyl-[1,2,4]triazolo[4,3-a]quinoline × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.67 Å R-free 0.221
5EWW Crystal structure of the human BRPF1 bromodomain in complex with SEED21 Deposited 2015-11-21	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740#	Not recorded	5SK ~{N}-[(2~{R})-butan-2-yl]-1-methyl-[1,2,4]triazolo[4,3-a]quinoxalin-4-amine × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.73 Å R-free 0.210
5FFV Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide Deposited 2015-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277.15 K；25% PEG3350, 0.2 M MgCl2, 0.1 M bis-tris pH 5.5	Resolution 1.30 Å R-free 0.206
5FFV Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide Deposited 2015-12-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277.15 K；25% PEG3350, 0.2 M MgCl2, 0.1 M bis-tris pH 5.5	Resolution 1.30 Å R-free 0.206
5FFW Crystal structure of the bromodomain of human BRPF1 in complex with H4K5acK8ac histone peptide Deposited 2015-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740 Chain B 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；0.2 M NaCl, 25% PEG3350, 0.1 M Hepes pH 7.5	Resolution 1.50 Å R-free 0.243
5FFY Crystal structure of the bromodomain of human BRPF1 in complex with a benzimidazole ligand Deposited 2015-12-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	5XD 4-ethyl-~{N}-(6-methoxy-1,3-dimethyl-2-oxidanylidene-benzimidazol-5-yl)benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；277.15 K；0.1 M bis tris propane pH 9, 10% ethylene glycol, 0.15 M sodium nitrate	Resolution 1.55 Å R-free 0.213
5FG4 Crystal structure of the bromodomain of human BRPF1 in complex with OF-1 chemical probe Deposited 2015-12-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	5XE 4-bromanyl-~{N}-(6-methoxy-1,3-dimethyl-2-oxidanylidene-benzimidazol-5-yl)-2-methyl-benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；277.15 K；25% PEG3350, 0.1M bis-tris propane pH 7.4, 5% ethyleneglycol, 0.15M sodium nitrate	Resolution 1.65 Å R-free 0.254
5FG5 Crystal structure of the bromodomain of human BRPF1 in complex with PFI-4 chemical probe Deposited 2015-12-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	5XF ~{N}-(1,3-dimethyl-2-oxidanylidene-6-pyrrolidin-1-yl-benzimidazol-5-yl)-2-methoxy-benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；15% PEG3350, 0.25 M sodium nitrate	Resolution 1.50 Å R-free 0.186
5FG5 Crystal structure of the bromodomain of human BRPF1 in complex with PFI-4 chemical probe Deposited 2015-12-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	5XF ~{N}-(1,3-dimethyl-2-oxidanylidene-6-pyrrolidin-1-yl-benzimidazol-5-yl)-2-methoxy-benzamide × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；15% PEG3350, 0.25 M sodium nitrate	Resolution 1.50 Å R-free 0.186
5G4R BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-6-2R-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1H-1,3-benzodiazol-5-yl-2- methoxybenzamide Deposited 2016-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 622–738（117 aa） Fragment：BROMODOMAIN OF BRPF1, UNP RESIDUES 622-738	Not recorded	LF1 N-[1,3-dimethyl-6-[(2R)-2-methylpiperazin-1-yl]-2-oxidanylidene-benzimidazol-5-yl]-2-methoxy-benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% P550MME_P20K, 0.1M BUFFER 3, PH8.5, 10% ETHYLENE GLYCOLS	Resolution 1.96 Å R-free 0.240
5G4R BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-6-2R-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1H-1,3-benzodiazol-5-yl-2- methoxybenzamide Deposited 2016-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 622–738（117 aa） Fragment：BROMODOMAIN OF BRPF1, UNP RESIDUES 622-738	Not recorded	LF1 N-[1,3-dimethyl-6-[(2R)-2-methylpiperazin-1-yl]-2-oxidanylidene-benzimidazol-5-yl]-2-methoxy-benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% P550MME_P20K, 0.1M BUFFER 3, PH8.5, 10% ETHYLENE GLYCOLS	Resolution 1.96 Å R-free 0.240
5G4R BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-6-2R-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1H-1,3-benzodiazol-5-yl-2- methoxybenzamide Deposited 2016-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 622–738（117 aa） Fragment：BROMODOMAIN OF BRPF1, UNP RESIDUES 622-738	Not recorded	LF1 N-[1,3-dimethyl-6-[(2R)-2-methylpiperazin-1-yl]-2-oxidanylidene-benzimidazol-5-yl]-2-methoxy-benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% P550MME_P20K, 0.1M BUFFER 3, PH8.5, 10% ETHYLENE GLYCOLS	Resolution 1.96 Å R-free 0.240
5G4R BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-6-2R-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1H-1,3-benzodiazol-5-yl-2- methoxybenzamide Deposited 2016-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 622–738（117 aa） Fragment：BROMODOMAIN OF BRPF1, UNP RESIDUES 622-738	Not recorded	LF1 N-[1,3-dimethyl-6-[(2R)-2-methylpiperazin-1-yl]-2-oxidanylidene-benzimidazol-5-yl]-2-methoxy-benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；30% P550MME_P20K, 0.1M BUFFER 3, PH8.5, 10% ETHYLENE GLYCOLS	Resolution 1.96 Å R-free 0.240
5G4S BROMODOMAIN OF HUMAN BRPF1 WITH N-1,3-dimethyl-6-2R-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1H-1,3-benzodiazol-5-yl-N- ethyl-2-methoxybenzamide Deposited 2016-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 624–738（115 aa） Fragment：BROMODOMAIN OF BRPF1, UNP RESIDUES 624-738	Not recorded	8VI N-[1,3-dimethyl-6-[(2R)-2-methylpiperazin-1-yl]-2-oxidanylidene-benzimidazol-5-yl]-N-ethyl-2-methoxy-benzamide × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1M MORPHEUS BUFFER 1, PH 6.5 37.5% MPD_P1K_P3350 10% MORPHEUS NITRATE-PHOSPHATE-SULPHATE	Resolution 1.60 Å R-free 0.194
5MWG Crystal structure of the human BRPF1 bromodomain in complex with BZ091 Deposited 2017-01-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	WGX ~{N}-[1,4-dimethyl-2,3-bis(oxidanylidene)-7-piperidin-1-yl-quinoxalin-6-yl]-5,6,7,8-tetrahydronaphthalene-2-sulfonamide × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium Nitrate, 20% PEG3350	Resolution 1.50 Å R-free 0.227
5MWG Crystal structure of the human BRPF1 bromodomain in complex with BZ091 Deposited 2017-01-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	WGX ~{N}-[1,4-dimethyl-2,3-bis(oxidanylidene)-7-piperidin-1-yl-quinoxalin-6-yl]-5,6,7,8-tetrahydronaphthalene-2-sulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium Nitrate, 20% PEG3350	Resolution 1.50 Å R-free 0.227
5MWZ Crystal structure of the human BRPF1 bromodomain in complex with BZ073 Deposited 2017-01-20	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	KGU ~{N}-[1,4-diethyl-2,3-bis(oxidanylidene)-7-piperidin-1-yl-quinoxalin-6-yl]-2-(4-methylpiperazin-1-yl)ethanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M Bis-Tris Propane pH7.4, 25% PEG3350, 5% EG, 0.15 M NaNO3	Resolution 1.25 Å R-free 0.181
5MYG Crystal structure of the bromodomain of human BRPF1 in complex with NI-57 chemical probe Deposited 2017-01-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	LS8 4-cyano-~{N}-(1,3-dimethyl-2-oxidanylidene-quinolin-6-yl)-2-methoxy-benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M ammonium acetate, 17% PEG 10K, 0.1 M bis-tris pH 5.5	Resolution 2.30 Å R-free 0.307
5MYG Crystal structure of the bromodomain of human BRPF1 in complex with NI-57 chemical probe Deposited 2017-01-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	LS8 4-cyano-~{N}-(1,3-dimethyl-2-oxidanylidene-quinolin-6-yl)-2-methoxy-benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M ammonium acetate, 17% PEG 10K, 0.1 M bis-tris pH 5.5	Resolution 2.30 Å R-free 0.307
5MYG Crystal structure of the bromodomain of human BRPF1 in complex with NI-57 chemical probe Deposited 2017-01-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 626–740（115 aa）	Not recorded	LS8 4-cyano-~{N}-(1,3-dimethyl-2-oxidanylidene-quinolin-6-yl)-2-methoxy-benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M ammonium acetate, 17% PEG 10K, 0.1 M bis-tris pH 5.5	Resolution 2.30 Å R-free 0.307
5MYG Crystal structure of the bromodomain of human BRPF1 in complex with NI-57 chemical probe Deposited 2017-01-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 626–740（115 aa）	Not recorded	LS8 4-cyano-~{N}-(1,3-dimethyl-2-oxidanylidene-quinolin-6-yl)-2-methoxy-benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M ammonium acetate, 17% PEG 10K, 0.1 M bis-tris pH 5.5	Resolution 2.30 Å R-free 0.307
5O4S Crystal structure of the human BRPF1 bromodomain in complex with BZ135 Deposited 2017-05-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	9KW ~{N}-[1,4-dimethyl-7-morpholin-4-yl-2,3-bis(oxidanylidene)quinoxalin-6-yl]-5,6,7,8-tetrahydronaphthalene-2-sulfonamide × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；297 K；0.1 M Bis-tris propane, pH6.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.75 Å R-free 0.221
5O4S Crystal structure of the human BRPF1 bromodomain in complex with BZ135 Deposited 2017-05-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	9KW ~{N}-[1,4-dimethyl-7-morpholin-4-yl-2,3-bis(oxidanylidene)quinoxalin-6-yl]-5,6,7,8-tetrahydronaphthalene-2-sulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；297 K；0.1 M Bis-tris propane, pH6.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.75 Å R-free 0.221
5O4T Crystal structure of the human BRPF1 bromodomain in complex with BZ061 Deposited 2017-05-30	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	9KT 1,4-dimethylquinoxaline-2,3-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.50 Å R-free 0.212
5O55 Crystal structure of the human BRPF1 bromodomain in complex with BZ047 Deposited 2017-05-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa） Fragment：UNP residues 626-740	Not recorded	NO3 NITRATE ION × 1 9L5 ~{N}-[(1~{S})-1-(1,5-dimethylpyrazol-4-yl)ethyl]-1-ethyl-3-methyl-2-oxidanylidene-quinoxaline-6-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.45 Å R-free 0.201
5O5A Crystal structure of the human BRPF1 bromodomain in complex with BZ032 Deposited 2017-06-01	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	NO3 NITRATE ION × 1 9LN 1-ethyl-~{N}-methyl-2,3-bis(oxidanylidene)-~{N}-[(1-phenylpyrazol-4-yl)methyl]-4~{H}-quinoxaline-6-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.60 Å R-free 0.202
5O5F Crystal structure of the human BRPF1 bromodomain in complex with BZ038 Deposited 2017-06-01	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	9LT 1-ethyl-~{N}-[(~{R})-(3-fluorophenyl)-(1-methylimidazol-2-yl)methyl]-2,3-bis(oxidanylidene)-4~{H}-quinoxaline-6-carboxamide × 1 NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium Nitrate, 20% PEG3350	Resolution 1.30 Å R-free 0.188
5O5H Crystal structure of the human BRPF1 bromodomain in complex with BZ053 Deposited 2017-06-01	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	9LK ~{N}-[6-(4-chloranylphenoxy)pyridin-3-yl]-2,4-dimethyl-1,3-oxazole-5-carboxamide × 2 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris Propane, pH6.5, 0.2 M Sodium Nitrate, 20% PEG3350	Resolution 1.85 Å R-free 0.235
5OV8 Crystal structure of the human BRPF1 bromodomain in complex with BZ097 Deposited 2017-08-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	AXN ~{N}-[1,4-dimethyl-2,3-bis(oxidanylidene)-7-pyrrolidin-1-yl-quinoxalin-6-yl]-4-(2-methylpropyl)benzenesulfonamide × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris Propane pH9, 10% EG, 0.15M NaNO3, 25% PEG3350	Resolution 1.80 Å R-free 0.244
5OV8 Crystal structure of the human BRPF1 bromodomain in complex with BZ097 Deposited 2017-08-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	AXN ~{N}-[1,4-dimethyl-2,3-bis(oxidanylidene)-7-pyrrolidin-1-yl-quinoxalin-6-yl]-4-(2-methylpropyl)benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris Propane pH9, 10% EG, 0.15M NaNO3, 25% PEG3350	Resolution 1.80 Å R-free 0.244
5OWA Crystal structure of the human BRPF1 bromodomain in complex with BZ054 Deposited 2017-08-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	B0H ~{N}-[4-[[(3~{S},5~{R})-3,5-dimethylpiperidin-1-yl]methyl]-1,3-thiazol-2-yl]-2,4-dimethyl-1,3-oxazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M MgCl2, 20% PEG3350	Resolution 1.95 Å R-free 0.268
5OWA Crystal structure of the human BRPF1 bromodomain in complex with BZ054 Deposited 2017-08-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	B0H ~{N}-[4-[[(3~{S},5~{R})-3,5-dimethylpiperidin-1-yl]methyl]-1,3-thiazol-2-yl]-2,4-dimethyl-1,3-oxazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M MgCl2, 20% PEG3350	Resolution 1.95 Å R-free 0.268
5OWA Crystal structure of the human BRPF1 bromodomain in complex with BZ054 Deposited 2017-08-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 626–740（115 aa）	Not recorded	B0H ~{N}-[4-[[(3~{S},5~{R})-3,5-dimethylpiperidin-1-yl]methyl]-1,3-thiazol-2-yl]-2,4-dimethyl-1,3-oxazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M MgCl2, 20% PEG3350	Resolution 1.95 Å R-free 0.268
5OWA Crystal structure of the human BRPF1 bromodomain in complex with BZ054 Deposited 2017-08-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 626–740（115 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M MgCl2, 20% PEG3350	Resolution 1.95 Å R-free 0.268
5OWB Crystal structure of the human BRPF1 bromodomain in complex with DSPBP1004 Deposited 2017-08-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	NO3 NITRATE ION × 1 AYW 4-methyl-6-oxidanyl-1-benzofuran-3-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Sodium Acetate, pH5.5, 0.15 M Sodium Nitrate, 20% PEG3350	Resolution 1.65 Å R-free 0.204
5OWE Crystal structure of the human BRPF1 bromodomain in complex with DSPBP1010 Deposited 2017-08-31	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	B0E 1,3-bis(oxidanyl)benzo[c]chromen-6-one × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-tris propane, pH6.5, 0.2 M Sodium nitrate, 20% PEG3350	Resolution 1.70 Å R-free 0.213
5T4U Crystal structure of the bromodomain of human BRPF1 in complex with a quinolinone ligand Deposited 2016-08-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 627–740（114 aa）	Not recorded	NO3 NITRATE ION × 1 12Q 1-METHYLQUINOLIN-2(1H)-ONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；20 % PEG3350, 0.2 M ammonium nitrate	Resolution 1.50 Å R-free 0.231
5T4V Crystal structure of the bromodomain of human BRPF1 in complex with NI-48 ligand Deposited 2016-08-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 627–740（114 aa）	Not recorded	N48 4-cyano-N-(7-methoxy-1,4-dimethyl-2-oxo-1,2-dihydroquinolin-6-yl)benzene-1-sulfonamide × 1 EDO 1,2-ETHANEDIOL × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；0.1 m bis-tris propane pH 8.5, 0.2 M sodium formate, 20% PEG 3350, 10% ethylene glycol	Resolution 1.65 Å R-free 0.250
6EKQ Crystal structure of the human BRPF1 bromodomain complexed with BZ054 in space group C2 Deposited 2017-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	B0H ~{N}-[4-[[(3~{S},5~{R})-3,5-dimethylpiperidin-1-yl]methyl]-1,3-thiazol-2-yl]-2,4-dimethyl-1,3-oxazole-5-carboxamide × 1 NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris Propane pH9, 10% EG, 0.15M NaNO3, 25% PEG3350	Resolution 1.65 Å R-free 0.182
6EKQ Crystal structure of the human BRPF1 bromodomain complexed with BZ054 in space group C2 Deposited 2017-09-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 626–740（115 aa）	Not recorded	B0H ~{N}-[4-[[(3~{S},5~{R})-3,5-dimethylpiperidin-1-yl]methyl]-1,3-thiazol-2-yl]-2,4-dimethyl-1,3-oxazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris Propane pH9, 10% EG, 0.15M NaNO3, 25% PEG3350	Resolution 1.65 Å R-free 0.182
6U04 Crystal structure of human BRPF1 PZP bound to histone H3 tail Deposited 2019-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 271–454（184 aa）	Not recorded	PR PRASEODYMIUM ION × 1 ZN ZINC ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291.15 K；0.2 M Lithium sulfate, 0.1 M Tris-HCl pH 8.5, 40% (v/v) PEG400, and 0.01M Praseodymium(III) acetate hydrate	Resolution 2.20 Å R-free 0.208
7C4I High resolution structure of BRPF1 Bromo Domain from Biortus Deposited 2020-05-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Not recorded	K POTASSIUM ION × 4 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Potassium fluoride, 20 %(w/v) PEG 3350	Resolution 1.37 Å R-free 0.194
8QAZ Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative compound 3 Deposited 2023-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Mutation：bromodomain (residues 626-740)	QA5 2-[4-[4-ethanoyl-5-methyl-3-(3-methylbutyl)-1~{H}-pyrrol-2-yl]-1,3-thiazol-2-yl]guanidine × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.18 M sodium nitrate, 30% PEG 3350, 5% ethylene glycol	Resolution 1.40 Å R-free 0.196
8QB0 Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative compound 2 Deposited 2023-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Mutation：bromodomain (residues 626-740)	Q9U 2-[4-(3,6,6-trimethyl-4-oxidanylidene-5,7-dihydro-2~{H}-isoindol-1-yl)-1,3-thiazol-2-yl]guanidine × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.18 M sodium nitrate, 30% PEG 3350, 5% ethylene glycol	Resolution 1.45 Å R-free 0.208
8QB2 Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative compound 79 Deposited 2023-08-24	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 626–740（115 aa）	Mutation：bromodomain (residues 626-740)	GKI 1-[2-methyl-4-(3-methylbutyl)-5-(2-piperazin-1-yl-1,3-thiazol-4-yl)-1~{H}-pyrrol-3-yl]ethanone × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277 K；0.18 M sodium nitrate, 30% PEG 3350	Resolution 1.42 Å R-free 0.196

64 other PDB entries and 93 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BRPF1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–116； UniProt 626–740 Author chain B； PDBConstruct 2–116； UniProt 626–740

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5mwh
Deposition date deposition_date	2017-01-18
Structure title title	Crystal structure of the human BRPF1 bromodomain in complex with BZ089
Keywords keywords	;Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA binding protein ;; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.65 Å
Radius of gyration Rg (electron density) rg_electron	18.87 Å
Forward intensity I(0) i0	12484500.00
Molecular weight molecular_weight	27003.0 kDa
Excluded volume excluded_volume	34045 Å³
Envelope volume envelope_volume	40603 Å³
Hydration-shell volume shell_volume	18220 Å³
Envelope diameter envelope_diameter	67.3 Å
Shell Rg shell_rg	24.85 Å
Envelope Rg envelope_rg	19.07 Å
Shape Rg shape_rg	18.85 Å
Total Rg total_rg	19.86 Å
Total atoms total_atoms	1903
Residues n_residues	224
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	67.5 Å
Rg (real space) rg_real	19.58 Å
Rg uncertainty (real space) rg_real_error	0.49 Å
I(0) (real space) i0_real	1.2480e+07
I(0) uncertainty (real space) i0_real_error	1.6080e+05
Rg (reciprocal space) rg_reciprocal	19.59 Å
I(0) (reciprocal space) i0_reciprocal	12480000.0000
Solution quality estimate total_estimate	0.7858
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	24.7 Å
Skewness Skewness skewness	0.254
Kurtosis Kurtosis kurtosis	-0.341
Angular range angular_range	— – 0.4050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4235000.0000
Real-space data points n_real_points	72
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.748; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.966; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Peregrin
Molecular weight formula_weight	13703.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2182

SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	~{N}-[1,4-dimethyl-7-morpholin-4-yl-2,3-bis(oxidanylidene)quinoxalin-6-yl]-4-(2-methylpropyl)benzenesulfonamide
Molecular weight formula_weight	486.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	NITRATE ION
Molecular weight formula_weight	62.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	240

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d5mwha_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.2 — Bromodomain
Family Family family	a.29.2.0 — automated matches

Domain ID domain_id	d5mwhb_
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.2 — Bromodomain
Family Family family	a.29.2.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	5mwhA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	920 — Histone Acetyltransferase; Chain A
Homologous superfamily homologous superfamily	10 — Bromodomain-like

Domain ID domain_id	5mwhB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	920 — Histone Acetyltransferase; Chain A
Homologous superfamily homologous superfamily	10 — Bromodomain-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	48.689 Å
Unit-cell length b length_b	63.279 Å
Unit-cell length c length_c	49.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	102.15 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.650 Å
Low-resolution limit resolution_low	38.190 Å
R factor r_factor	0.1817
R_work r_work	0.1789
R_free r_free	0.2256

fit	/app/data/saxs_computation/mw/5mwh/5mwh.fit
pddf	/app/data/pr_computation/mw/5mwh/5mwh.pr.out
profile	/app/data/saxs_computation/mw/5mwh/5mwh.dat