5n9j

Core Mediator of transcriptional regulation

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mediator of RNA polymerase II transcription subunit 14

Schizosaccharomyces pombe

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED14_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–591； UniProt 2–580

Mediator of RNA polymerase II transcription subunit 10

Schizosaccharomyces pombe

UniProt P87310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED10_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–144； UniProt 1–144

Mediator of RNA polymerase II transcription subunit 19

Schizosaccharomyces pombe

UniProt Q9Y7N2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED19_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–138； UniProt 1–138

Mediator of RNA polymerase II transcription subunit 21

Schizosaccharomyces pombe

UniProt O94376

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED21_SCHPO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–138； UniProt 1–138

Mediator of RNA polymerase II transcription subunit 7

Schizosaccharomyces pombe

UniProt O60104

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED7_SCHPO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–376； UniProt 1–376

Mediator Complex Subunit 9

Schizosaccharomyces pombe

UniProt O13964

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YE44_SCHPO
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–121； UniProt 1–121

Mediator of RNA polymerase II transcription subunit 4

Schizosaccharomyces pombe

UniProt Q9Y821

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED4_SCHPO
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–239； UniProt 1–239

Mediator of RNA polymerase II transcription subunit 31

Schizosaccharomyces pombe

UniProt Q9USH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED31_SCHPO
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain R； PDBConstruct 1–139； UniProt 1–139

Mediator of RNA polymerase II transcription subunit 6

Schizosaccharomyces pombe

UniProt Q9US45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED6_SCHPO
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain S； PDBConstruct 1–216； UniProt 1–216

Mediator of RNA polymerase II transcription subunit 8

Schizosaccharomyces pombe

UniProt O94646

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED8_SCHPO
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–200； UniProt 1–200

Mediator of RNA polymerase II transcription subunit 11

Schizosaccharomyces pombe

UniProt Q9P6Q0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED11_SCHPO
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 1–112； UniProt 1–112

Mediator of RNA polymerase II transcription subunit 17

Schizosaccharomyces pombe

UniProt P87306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED17_SCHPO
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain W； PDBConstruct 1–545； UniProt 1–545

Mediator of RNA polymerase II transcription subunit 18

Schizosaccharomyces pombe

UniProt O14198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED18_SCHPO
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain X； PDBConstruct 4–210； UniProt 1–207

Mediator of RNA polymerase II transcription subunit 20

Schizosaccharomyces pombe

UniProt Q10317

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED20_SCHPO
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Y； PDBConstruct 1–193； UniProt 1–193

Mediator of RNA polymerase II transcription subunit 22

Schizosaccharomyces pombe

UniProt O14010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mediator of RNA polymerase II transcription subunit 14 × 1 （Q9P7Y4） Mediator of RNA polymerase II transcription subunit 10 × 1 （P87310） Mediator of RNA polymerase II transcription subunit 19 × 1 （Q9Y7N2） Mediator of RNA polymerase II transcription subunit 21 × 1 （O94376） Mediator of RNA polymerase II transcription subunit 7 × 1 （O60104） Mediator Complex Subunit 9 × 1 （O13964） Mediator of RNA polymerase II transcription subunit 4 × 1 （Q9Y821） Mediator of RNA polymerase II transcription subunit 31 × 1 （Q9USH1） Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 20 × 1 （Q10317）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED22_SCHPO
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Z； PDBConstruct 1–136； UniProt 1–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5n9j
Deposition date deposition_date	2017-02-25
Structure title title	Core Mediator of transcriptional regulation
Keywords keywords	Transcription, RNA polymerase II; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5n9j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5n9j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5n9j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.14 Å
Rg (electron density)	65.81 Å
Total Rg	65.67 Å
Atom count	23721
Residues	2929
Excluded volume	424020 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5n9j__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Mediator of RNA polymerase II transcription subunit 14
Molecular weight formula_weight	68020.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	23721

MGHHHHHHHHHHEPPAIPHITEGFYPLPEIVETFSHHVLQELVSLAEVLPSMSNVEKKKKILDWLLRSRAFTMRLLVLARWVHLSPSVHRCIDVVAFLQGQKFCFQNLVHVLQDIRYQLSFARLRNSDLVTALDILSTGTSLRLANAPTSKLYMLSESPLSTKQILQTLHALNMLIRIRLSLYEIIPTPFQHFTIANGRCTFTVPNEFSVSLTTNSQDPKSTGISFQWIVVDFQFHLPDFSSTPAKYRVFIELHLNEEIAAAFVLQKPILPLIYNILHKFCLYQRLNLLSQQTFQLSRESWLGHLRGVYDEKPPRLRLYYWPQLNVKKEGKPGKIGHYIHIFVNTQPISAFERTLSSKRSSCEYDHFLLLVEWHHDGIVEHVPLDDHMDAQHLLLLITQKHAQLILEQIRKELHPNIFSEHVGGGLKIHVFDNEIIVKVNSVTGRLVLSSSASPLSPPRHLRAAEKNIALNTQPPAQILNRLYFFCIQTQLLEVAQCAELHAVQGYYSFPYLTFSKGKWRKDGDSLWVLAYNVESNSWSVRLLNAAGQTLYTQDVHTTKGTLSIESFSRLSYLLEVQILLFNVQTACQARG

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Mediator of RNA polymerase II transcription subunit 10
Molecular weight formula_weight	16352.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLPQDDMTDEMKSLASRLEDTTQAFYDLALIVYNLEDTTPSDAIPESLDTLIRDLKSLPDISRKVNNLIPQDVLEYIEQGRNPDVYARQFSELVQKDNQYVNGKLYAIEGFQKAFAEEIKQAYPEVSSVVDKILNEGKVESTVS

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Mediator of RNA polymerase II transcription subunit 19
Molecular weight formula_weight	15952.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAQAPEYHYVGSVDYQPTRPSAHQNLIELYGLTELAKKVGRVDEFGNKRKMRRSYKAYIQDLPGYNEILRDNTIKQWLTNPIREEVPIDIEFLHHVFSVEPGIIPGFNPKVFGLEDDVVMGNVSRDSSQPRSPSRRKK

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Mediator of RNA polymerase II transcription subunit 21
Molecular weight formula_weight	15821.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MACRCTQLQDTIDEVATQFYSSIHYLSSHHDFVPLPGQEKVSDSKVNPISAEELQFAQRDLAKDLVTKFMQIDTLINQLPGISTAPKHQLEKIKKLQNSIEEKQLERKSLESENEDLKLQLAKRIETFGRLSCVLFQP

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	Mediator of RNA polymerase II transcription subunit 7
Molecular weight formula_weight	43573.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEPNEGVQLFSAFPPPPPYYKLFTRENIEKVISNMEKEAKHEDDANTLQPKTEEEIESLAKLFKKPSCLTSGTYQMFGDTWRLDEAIPSLKEFGIPELYKDIKDGEDEIEVVEYDPKSNAIVGTSFTRVHDYDKNSPIENEKILEDDQHTAMKEKDNESDKTMKDVEEKTEPSLKKEEEDIQMKEPLDSQDTGAVSASSVNEGFRADQKSKDGETSDLIKIPRRAYELRFLSRSLMLNFLELLGIMAKAPEQFPSKVENIRVLLLNLHHLINDYRPHQSRESLIMLLEKQLKHEESQVELLRTHNRQMTETLEKYKSLDFNMEKEGDVIQQLKSSIKKPLSGAEDEQKSRSMFSKNDEKLKKSLELMEDVIKRDLS

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	Mediator Complex Subunit 9
Molecular weight formula_weight	13811.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MDPAHHIKDTSAELLSQQDFSILQSRLLEFLASQEARETVTASKELTLLRQGIRQLKEKVSKMEPEEMTVKEKKSIIEILKARIALKKAFLKMALSESNDTVVKKEDVRESPVDTFMENAT

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 7 Entity 7 polymer

Description description	Mediator of RNA polymerase II transcription subunit 4
Molecular weight formula_weight	27370.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MEYQRAIDSIEECLNKQLRLSSEKVDQYVLIENWTSLVGHLKTLHSLISNYTNGRELQNEISSLLKQDKELDLQIQDCMREMTSIYDTHLPKTVSGRKRQKVNAETLLDYGRKLSKFSSAPPGYNPETGQDAKAPVHYPWPSEDQMRKTLLFQFSTSMVPNLSATASQLFSEQPPKTNEPTETETEIDANKAVEEKTKMNYPASPTFTTQEENKEVESPANKDVFAGFDLFDPEMEEDF

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 8 Entity 8 polymer

Description description	Mediator of RNA polymerase II transcription subunit 31
Molecular weight formula_weight	16914.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

METKWLLSKVPDDKSRFEIELEFVQMLSNPWYLNFLAQHKYFEDEAFLQYLEYMEYWREPEYVKFIIYPTCLHMLTLLKNPQFRNDISRADLSKQVNDEIYYEWLGKGLQQYGSADDATLSQPQQEEDEKKVDVKKENE

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 9 Entity 9 polymer

Description description	Mediator of RNA polymerase II transcription subunit 6
Molecular weight formula_weight	24928.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MASGAPPSVDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIEKFPQYNPQEGYTYPKLSNDNLEVDHSNTNEPADENKNQSIENADYSFSPEDFSVVRAFMQSLHSSKEAPDVK

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 10 Entity 10 polymer

Description description	Mediator of RNA polymerase II transcription subunit 8
Molecular weight formula_weight	23360.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MEDISTEKTVESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSIYPSLEFPVKEQEPLLTTLLRTKALPEVEEWEANTLQEYEASISSQPKKKEANDAYQKDQLWDQARIIFMEERENYSWFDFVTRRQESEGEFVSQRQLEIDRATEEQNANQMLTDILSFMKSGKR

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 11 Entity 11 polymer

Description description	Mediator of RNA polymerase II transcription subunit 11
Molecular weight formula_weight	12644.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MTNSDDDLFSEKSTSSDTQQVQNILELEAKIPDILSSAGKCIEAIQLNNSLEDFRKYSKEFLETVEFISTGLRRQALELEKAEVPVVSLQPKKRYASTPLSNLIFDQSSKLM

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 12 Entity 12 polymer

Description description	Mediator of RNA polymerase II transcription subunit 17
Molecular weight formula_weight	62551.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAEEANKDADISSLSLSLDPEIIGGQNNFLENNLQQIFQKIIQERGPFRDLKEEDLQKELQKESIKDESSAKSSETENVLEFATLDSKRNVNDTEVESMDSQAYKKELIEQIMIAQTECSLALDMTSLLLSKFKENSIETISPFLKSTVPPSSLQFSRSQPPESKESDATLAKCWKEKSLTSSCKFLFEAKERLTSVVETEHEYYTELVKVKEASWPLFNSQGSNHLSVQYSCLGGISLGLGLIRMKPESKSFEVQSSLLYSQAALKISILNKDRDEIGSSTWSWPSQNCNSVLLKDIYKLQEILFEMDIWNSLLQEAQSCGNQGVNFTGDEILVPISDDHVVRITLETSSKNTESGFTEDKKSNEDTSTNFVTIKQEKELLKCLCDTLNAIAHILFLKHCRKSDRRSQQPELYMAIDANAPLILRPLIFYYNLNQESLEFQRWLKQRDISFKFMPNYPWEKAKDFLELENSLSINRLSISWRIMVSNFEPAIFIQHTPTLHGTDKSVWRCKDQYSSNQFSSLKNVCQYIEHHINSLSRRSKKTE

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 13 Entity 13 polymer

Description description	Mediator of RNA polymerase II transcription subunit 18
Molecular weight formula_weight	24345.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MASMQELYLLGVVPSRRFEAVVNSLSKTLDGPKTILEFWVVYRPKDVPPNLPRQPDSWLRLCSNIESHDETDTEWSKNTQWSMYLEGNSEPKREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEYIIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFHPMNEEQPWILHVYTHVADASNQVAMAKAEANLTKVKTLLSAFCDLKNVRL

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 14 Entity 14 polymer

Description description	Mediator of RNA polymerase II transcription subunit 20
Molecular weight formula_weight	22374.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MPVHGVIYYSSPSMATFLSPAQDNLVRTYFAQHLKKWVVQYKLYRNAVTPKTLEFLKQNINPSMLACVDEATMIDAEPELEDIIVRTKLWNFRQSFTIEGSIYEVGSFKVAIANVLQKSVWKGILFHVTYDGTESVDLARPIIQEFFLKCFLQNNKSVTPVYESFFNQPRHSLDSKLLLQLFKQRIDTVSQRT

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 15 Entity 15 polymer

Description description	Mediator of RNA polymerase II transcription subunit 22
Molecular weight formula_weight	15396.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	4896
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	5n9jR00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1340 — Mediator of RNA polymerase II, submodule Med31 (Soh1)

Domain ID domain_id	5n9jV00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3490 —

Domain ID domain_id	5n9jX00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

▶

Unit-cell length a length_a	145.864 Å
Unit-cell length b length_b	211.768 Å
Unit-cell length c length_c	267.028 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	98.486 Å
R factor r_factor	0.2343
R_work r_work	0.2331
R_free r_free	0.2560

Core Mediator of transcriptional regulation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mediator of RNA polymerase II transcription subunit 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator Complex Subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer