SAXSdb — 5nqz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein

Neisseria meningitidis MC58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ZINC ION × 6 ACETATE ION × 5 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ZINC ION × 3 ACETATE ION × 3 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OMPA1_NEIMC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 238–249； UniProt 195–206 Author chain B； PDBConstruct 238–249； UniProt 195–206

Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein

Neisseria meningitidis MC58

UniProt Q9JXV4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ZINC ION × 6 ACETATE ION × 5 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ZINC ION × 3 ACETATE ION × 3 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9JXV4_NEIMB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–237； UniProt 73–308 Author chain A； PDBConstruct 250–261； UniProt 309–320 Author chain B； PDBConstruct 2–237； UniProt 73–308 Author chain B； PDBConstruct 250–261； UniProt 309–320

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5nqz
Deposition date deposition_date	2017-04-21
Structure title title	Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.
Keywords keywords	Meningitis, Vaccine, Complement, Chimeric, immune system; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5nqz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5nqz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5nqz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.70 Å
Rg (electron density)	20.52 Å
Total Rg	21.49 Å
Atom count	2066
Residues	267
Excluded volume	36375 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5nqz__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5nqz__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein
Molecular weight formula_weight	29127.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4631

MVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVYYTKDTNNNLTLVGIRHIGLAAKQLEHHHHHH

Source Source

Source organism organism	Neisseria meningitidis MC58
NCBI taxonomy ID ncbi_taxonomy_id	122586
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	540

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	5nqzA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1980 —

Domain ID domain_id	5nqzA02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	5nqzB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1980 —

Domain ID domain_id	5nqzB02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	90 —

▶

Unit-cell length a length_a	91.370 Å
Unit-cell length b length_b	76.270 Å
Unit-cell length c length_c	83.900 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.26 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.630 Å
Low-resolution limit resolution_low	58.550 Å
R factor r_factor	0.1635
R_work r_work	0.1620
R_free r_free	0.1944

Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nqz__assembly_1__model_1

5nqz__assembly_1__model_1 | I(q)

5nqz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Factor H binding protein,Major outer membrane protein P.IA,Factor H binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nqz__assembly_1__model_1

5nqz__assembly_1__model_1 | I(q)

5nqz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)