SAXSdb — 5nwk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

14-3-3 c-1 protein

Nicotiana tabacum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Potassium channel KAT1 × 2 （Q39128） FUSICOCCIN × 1 PHOSPHOSERINE × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Potassium channel KAT1 × 2 （Q39128） FUSICOCCIN × 2 water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Potassium channel KAT1 × 2 （Q39128） FUSICOCCIN × 2 water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Potassium channel KAT1 × 2 （Q39128） FUSICOCCIN × 2 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5KTN5_TOBAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–262； UniProt 1–260 Author chain B； PDBConstruct 3–262； UniProt 1–260 Author chain C； PDBConstruct 3–262； UniProt 1–260 Author chain D； PDBConstruct 3–262； UniProt 1–260 Author chain E； PDBConstruct 3–262； UniProt 1–260 Author chain F； PDBConstruct 3–262； UniProt 1–260 Author chain G； PDBConstruct 3–262； UniProt 1–260 Author chain H； PDBConstruct 3–262； UniProt 1–260

Potassium channel KAT1

OrganismNot specified

UniProt Q39128

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	14-3-3 c-1 protein × 2 （Q5KTN5） FUSICOCCIN × 1 PHOSPHOSERINE × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	14-3-3 c-1 protein × 2 （Q5KTN5） FUSICOCCIN × 2 water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	14-3-3 c-1 protein × 2 （Q5KTN5） FUSICOCCIN × 2 water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	14-3-3 c-1 protein × 2 （Q5KTN5） FUSICOCCIN × 2 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KAT1_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain P； PDBConstruct 1–5； UniProt 673–677 Author chain Q； PDBConstruct 1–5； UniProt 673–677 Author chain R； PDBConstruct 1–5； UniProt 673–677 Author chain S； PDBConstruct 1–5； UniProt 673–677 Author chain T； PDBConstruct 1–5； UniProt 673–677 Author chain U； PDBConstruct 1–5； UniProt 673–677 Author chain V； PDBConstruct 1–5； UniProt 673–677 Author chain W； PDBConstruct 1–5； UniProt 673–677

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5nwk
Deposition date deposition_date	2017-05-06
Structure title title	14-3-3c in complex with CPP and fusicoccin
Keywords keywords	potassium channel, fusicoccin, complex, 14-3-3m, signaling protein; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5nwk__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5nwk__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5nwk__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.48 Å
Rg (electron density)	26.43 Å
Total Rg	27.21 Å
Atom count	3948
Residues	481
Excluded volume	70232 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5nwk__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5nwk__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5nwk__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5nwk__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	14-3-3 c-1 protein
Molecular weight formula_weight	29554.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	15163

PGMAVAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPDEAKN

Source Source

Source organism organism	Nicotiana tabacum
Common name common_name	Common tobacco
NCBI taxonomy ID ncbi_taxonomy_id	4097
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Potassium channel KAT1
Molecular weight formula_weight	696.6 kDa
Source method src_method	syn
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,R,S,T,U,V,W

YFSSN

Entity 3 Entity 3 non-polymer

Description description	FUSICOCCIN
Molecular weight formula_weight	680.8 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 4 Entity 4 non-polymer

Description description	PHOSPHOSERINE
Molecular weight formula_weight	185.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	101

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	5nwkA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	5nwkH00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

▶

Unit-cell length a length_a	99.806 Å
Unit-cell length b length_b	165.661 Å
Unit-cell length c length_c	170.552 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	48.318 Å
R factor r_factor	0.2308
R_work r_work	0.2289
R_free r_free	0.2858

14-3-3c in complex with CPP and fusicoccin

1. Protein Identity and Related Structures Protein Identity & Related Structures

14-3-3 c-1 protein

State in the Current Structure

Other States of the Same Protein in the Database

Potassium channel KAT1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nwk__assembly_4__model_1

5nwk__assembly_4__model_1 | I(q)

5nwk__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

14-3-3c in complex with CPP and fusicoccin

1. Protein Identity and Related Structures Protein Identity & Related Structures

14-3-3 c-1 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Potassium channel KAT1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nwk__assembly_4__model_1

5nwk__assembly_4__model_1 | I(q)

5nwk__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)