SAXSdb — 5o7h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein, Csy4 family

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 5 RNA 1	crRNA × 1 Cas7fv × 3 （A4Y6G1） Cas5fv × 1 （A4Y6G2）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A4Y6G3_SHEPC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–167； UniProt 16–181

Cas7fv

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

UniProt A4Y6G1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 5 RNA 1	crRNA × 1 CRISPR-associated protein, Csy4 family × 1 （A4Y6G3） Cas5fv × 1 （A4Y6G2）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A4Y6G1_SHEPC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 2–315； UniProt 2–315 Author chain D； PDBConstruct 2–315； UniProt 2–315 Author chain E； PDBConstruct 2–315； UniProt 2–315

Cas5fv

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

UniProt A4Y6G2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 5 RNA 1	crRNA × 1 CRISPR-associated protein, Csy4 family × 1 （A4Y6G3） Cas7fv × 3 （A4Y6G1）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A4Y6G2_SHEPC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 2–336； UniProt 2–336

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5o7h
Deposition date deposition_date	2017-06-08
Structure title title	Structure of the Cascade-I-Fv complex from Shewanella putrefaciens
Keywords keywords	RNA SURVEILLANCE, ADAPTIVE IMMUNITY, CRISPR, CASCADE, ANTIVIRAL PROTEIN; ANTIVIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5o7h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5o7h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5o7h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.01 Å
Rg (electron density)	40.80 Å
Total Rg	41.00 Å
Atom count	12262
Residues	1387
Excluded volume	207540 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5o7h__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	crRNA
Molecular weight formula_weight	13756.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	12262

CUUAGAAAGCAAACCUAUAACCGUUCACCGCCGCACAGGCGGC

Source Source

Source organism organism	Shewanella putrefaciens CN-32
NCBI taxonomy ID ncbi_taxonomy_id	319224
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	CRISPR-associated protein, Csy4 family
Molecular weight formula_weight	18863.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MREAELSSKVFTKFHKALVTLNSHKIGISFPQMKLSLGQLFRIHGDASLLHDLQGLDWLGPLAGYCQVTAVSAVPDHVQYRIVSVKRSNLSKAKLKRLIARGSIDKDGEKRYKVKMLGQGFDNPYLDLFSSSTGQVYRKFFEFSDIQAHPLDGEFDSYGLSKTATVP

Source Source

Source organism organism	Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
NCBI taxonomy ID ncbi_taxonomy_id	319224
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Cas7fv
Molecular weight formula_weight	35836.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E

MQKVTGIKSVDFKIKALGHGVVNWNGPTTLTGDDGKTVDNHTLPKLRGYTNLTGKVKDETGYKYKKQATDINFKETPLYISQNCIRHHLFREQAFDLHYASDKNLKNVLASITGLIRGYVVPSSQCKRTSPLLLEDFVDQLGNGNFEQYGQAGARDSTSFFSKTTFGDTEYISYGSISIEQLQFISLDKKFDRAAMVIKEGEGEVIAAELQNYIQSLNPSLNPQAIFHSNYVRRGTIFEEGECGILLNDDAVKALVAETLERLANLSIRQAKGYMYVDDITVDYNDSHKMMRIKRDESEIINEQHAPFAQYFYAK

Source Source

Source organism organism	Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
NCBI taxonomy ID ncbi_taxonomy_id	319224
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Cas5fv
Molecular weight formula_weight	38373.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MKIIIEYDSCWRNAFLGGSNNEPVPKKGREFLGSMTSLKKEGNFKVCENTLDTVMGVLNRLIGDQRKLYQARSKMYESAYYFEALEDKVSFIDKPQLTNEISFIRNMNGSTDQNAFTGMIKVSDPVFTSEYSQQFWGVLALDFTQLCDFIIKQSQVVGSIELNPLSIINRLESLNQEKALENSDDLAQVLKVLNEYFPDIEYLNNKGLITPISIYCSALYLQLARLETSFNMTTAKTKAGGISGISKRGFTKKDFMDRYTTGPKKTIWGNPFIKKEKIKGQGEVTSMMTKASGQLEISIDVDRDKAQEIKILIENAGVSSFYLGKKGLAYVSNIKL

Source Source

Source organism organism	Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
NCBI taxonomy ID ncbi_taxonomy_id	319224
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	157.002 Å
Unit-cell length b length_b	65.894 Å
Unit-cell length c length_c	160.682 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.61 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	I 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	49.288 Å
R factor r_factor	0.2235
R_work r_work	0.2213
R_free r_free	0.2671

Structure of the Cascade-I-Fv complex from Shewanella putrefaciens

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein, Csy4 family

State in the Current Structure

Other States of the Same Protein in the Database

Cas7fv

State in the Current Structure

Other States of the Same Protein in the Database

Cas5fv

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5o7h__assembly_1__model_1

5o7h__assembly_1__model_1 | I(q)

5o7h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of the Cascade-I-Fv complex from Shewanella putrefaciens

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein, Csy4 family

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cas7fv

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cas5fv

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5o7h__assembly_1__model_1

5o7h__assembly_1__model_1 | I(q)

5o7h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)