SAXSdb — 5t0v

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Iron sulfur cluster assembly protein 1, mitochondrial

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Frataxin homolog, mitochondrial × 24 （Q07540）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISU1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 5–142； UniProt 28–165 Author chain b； PDBConstruct 5–142； UniProt 28–165 Author chain c； PDBConstruct 5–142； UniProt 28–165 Author chain d； PDBConstruct 5–142； UniProt 28–165 Author chain e； PDBConstruct 5–142； UniProt 28–165 Author chain f； PDBConstruct 5–142； UniProt 28–165 Author chain g； PDBConstruct 5–142； UniProt 28–165 Author chain h； PDBConstruct 5–142； UniProt 28–165 Author chain i； PDBConstruct 5–142； UniProt 28–165 Author chain j； PDBConstruct 5–142； UniProt 28–165 Author chain k； PDBConstruct 5–142； UniProt 28–165 Author chain l； PDBConstruct 5–142； UniProt 28–165 Author chain m； PDBConstruct 5–142； UniProt 28–165 Author chain n； PDBConstruct 5–142； UniProt 28–165 Author chain o； PDBConstruct 5–142； UniProt 28–165 Author chain p； PDBConstruct 5–142； UniProt 28–165 Author chain q； PDBConstruct 5–142； UniProt 28–165 Author chain r； PDBConstruct 5–142； UniProt 28–165 Author chain s； PDBConstruct 5–142； UniProt 28–165 Author chain t； PDBConstruct 5–142； UniProt 28–165 Author chain u； PDBConstruct 5–142； UniProt 28–165 Author chain v； PDBConstruct 5–142； UniProt 28–165 Author chain w； PDBConstruct 5–142； UniProt 28–165 Author chain x； PDBConstruct 5–142； UniProt 28–165

Frataxin homolog, mitochondrial

Saccharomyces cerevisiae

UniProt Q07540

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Iron sulfur cluster assembly protein 1, mitochondrial × 24 （Q03020）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FRDA_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–121； UniProt 52–172 Author chain B； PDBConstruct 1–121； UniProt 52–172 Author chain C； PDBConstruct 1–121； UniProt 52–172 Author chain D； PDBConstruct 1–121； UniProt 52–172 Author chain E； PDBConstruct 1–121； UniProt 52–172 Author chain F； PDBConstruct 1–121； UniProt 52–172 Author chain G； PDBConstruct 1–121； UniProt 52–172 Author chain H； PDBConstruct 1–121； UniProt 52–172 Author chain I； PDBConstruct 1–121； UniProt 52–172 Author chain J； PDBConstruct 1–121； UniProt 52–172 Author chain K； PDBConstruct 1–121； UniProt 52–172 Author chain L； PDBConstruct 1–121； UniProt 52–172 Author chain M； PDBConstruct 1–121； UniProt 52–172 Author chain N； PDBConstruct 1–121； UniProt 52–172 Author chain O； PDBConstruct 1–121； UniProt 52–172 Author chain P； PDBConstruct 1–121； UniProt 52–172 Author chain Q； PDBConstruct 1–121； UniProt 52–172 Author chain R； PDBConstruct 1–121； UniProt 52–172 Author chain S； PDBConstruct 1–121； UniProt 52–172 Author chain T； PDBConstruct 1–121； UniProt 52–172 Author chain U； PDBConstruct 1–121； UniProt 52–172 Author chain V； PDBConstruct 1–121； UniProt 52–172 Author chain W； PDBConstruct 1–121； UniProt 52–172 Author chain X； PDBConstruct 1–121； UniProt 52–172

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5t0v
Deposition date deposition_date	2016-08-16
Structure title title	Architecture of the Yeast Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Sub-Complex Formed by the Iron Donor, Yfh1, and the Scaffold, Isu1
Keywords keywords	Friedreich Ataxia, frataxin, iron-sulfur protein, mitochondria, protein complex, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5t0v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5t0v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5t0v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.02 Å
Rg (electron density)	52.34 Å
Total Rg	52.73 Å
Atom count	48456
Residues	6312
Excluded volume	865850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5t0v__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Iron sulfur cluster assembly protein 1, mitochondrial
Molecular weight formula_weight	15383.9 kDa
Source method src_method	man
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x
Atom count atom_count	48456

GSHMSSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTMLS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli #1/H766

Entity 2 Entity 2 polymer

Description description	Frataxin homolog, mitochondrial
Molecular weight formula_weight	13456.0 kDa
EC 编号 ec_number	1.16.3.1
Source method src_method	man
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X

VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli #1/H766

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	17.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	4153

Architecture of the Yeast Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Sub-Complex Formed by the Iron Donor, Yfh1, and the Scaffold, Isu1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Iron sulfur cluster assembly protein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Frataxin homolog, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5t0v__assembly_1__model_1

5t0v__assembly_1__model_1 | I(q)

5t0v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Architecture of the Yeast Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Sub-Complex Formed by the Iron Donor, Yfh1, and the Scaffold, Isu1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Iron sulfur cluster assembly protein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Frataxin homolog, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5t0v__assembly_1__model_1

5t0v__assembly_1__model_1 | I(q)

5t0v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)