SAXSdb — 5t7l

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Copper transport protein ATOX1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 2–68	Not recorded	Copper-transporting ATPase 1 × 1 （Q04656） PT PLATINUM (II) ION × 2 CU COPPER (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；PEG-6000 10 to 30 % w/v and sodium citrate 0.1M at pH 4.7	Resolution 2.83 Å R-free 0.273

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5T7L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1FE0 CRYSTAL STRUCTURE OF CADMIUM-HAH1 Deposited 2000-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa） Chain B 1–68（68 aa）	Not recorded	SO4 SULFATE ION × 2 CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；MES buffer, lithium sulfate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.75 Å R-free 0.213
1FE4 CRYSTAL STRUCTURE OF MERCURY-HAH1 Deposited 2000-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa） Chain B 1–68（68 aa）	Not recorded	IUM URANYL (VI) ION × 1 SO4 SULFATE ION × 2 HG MERCURY (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；MES buffer, ammonium sulfate, magnesium chloride, dithiothreitol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.75 Å R-free 0.218
1FEE CRYSTAL STRUCTURE OF COPPER-HAH1 Deposited 2000-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa） Chain B 1–68（68 aa）	Not recorded	CU1 COPPER (I) ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；Strictly anaerobic. MES buffer, lithium sulfate, and dithiothreitol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.216
1TL4 Solution structure of Cu(I) HAH1 Deposited 2004-06-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 10 mM sodium acetate；Pressure ambient NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100 mM phosphate buffer；Pressure ambient NMR sample composition 1.0 mM Cu(I)HAH1 U-15N; 10 mM sodium acetate \| 90% H2O/10% D2O NMR sample composition 2 mM Cu(I)HAH1 U-95% 13C,U-98% 15N; 4 mM DTT; 100 mM phosphate buffer \| 90% H2O/10% D2O	Resolution not provided
1TL5 Solution structure of apoHAH1 Deposited 2004-06-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100 mM phosphate buffer；Pressure ambient NMR sample composition 1.0 mM apoHAH1 U-15N; 5mM DTT; 100 mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 2 mM apoHAH1 U-95% 13C,U-98% 15N; 5 mM DTT; 100 mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 2 mM unlabelled apoHAH1 ; 5 mM DTT; 100 mM phosphate buffer \| 90% H2O/10% D2O	Resolution not provided
2K1R The solution NMR structure of the complex between MNK1 and HAH1 mediated by Cu(I) Deposited 2008-03-14	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–68（68 aa）	Not recorded	CU COPPER (II) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Pressure ambient NMR measurement conditions pH 7；298 K；Pressure ambient NMR measurement conditions pH 7；298 K；Pressure ambient NMR measurement conditions pH 7；298 K；Pressure ambient NMR sample composition 0.6 mM MNK1, 0.6 mM [U-100% 13C; U-100% 15N] HAH1, 0.6 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-100% 13C; U-100% 15N] MNK1, 0.6 mM HAH1, 0.6 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-100% 13C; U-100% 15N] MNK1, 1.0 mM HAH1, 1.0 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1.0 mM MNK1, 0.6 mM [U-100% 13C; U-100% 15N] HAH1, 1.0 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2LQ9 Solution structure of the K60A mutant of Atox1 Deposited 2012-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Mutation：K60A	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0.215；Pressure ambient NMR sample composition 0.4-0.5 mM [U-100% 13C; U-100% 15N] entity-1, 100 mM sodium phosphate-2, 2-2.5 mM DTT-3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.4-0.5 mM [U-100% 15N] entity-4, 100 mM sodium phosphate-5, 2-2.5 mM DTT-6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.4-0.5 mM [U-100% 13C; U-100% 15N] entity-7, 100 mM sodium phosphate-8, 2-2.5 mM DTT-9, 100% D2O \| 100% D2O	Resolution not provided
3CJK Crystal structure of the adduct HAH1-Cd(II)-MNK1. Deposited 2008-03-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–68（67 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；298 K；0.1 M sodium citrate, 20% PEG-6000, pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.283
3IWL Crystal structure of cisplatin bound to a human copper chaperone (monomer) Deposited 2009-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	PT PLATINUM (II) ION × 1 SO4 SULFATE ION × 1 TCE 3,3',3''-phosphanetriyltripropanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；294 K；2M lithium sulfate, 0.1M MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.60 Å R-free 0.210
3IWL Crystal structure of cisplatin bound to a human copper chaperone (monomer) Deposited 2009-09-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa）	Not recorded	PT PLATINUM (II) ION × 2 SO4 SULFATE ION × 2 TCE 3,3',3''-phosphanetriyltripropanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；294 K；2M lithium sulfate, 0.1M MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.60 Å R-free 0.210
3IWX Crystal structure of cisplatin bound to a human copper chaperone (dimer) Deposited 2009-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa） Chain B 1–68（68 aa）	Not recorded	CPT Cisplatin × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；294 K；1.5 M lithium sulfate, 0.1M MES, 50 mM NaCl, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.14 Å R-free 0.228
4QOT Crystal structure of human copper chaperone bound to the platinum ion Deposited 2014-06-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa） Chain B 1–68（68 aa）	Not recorded	PT PLATINUM (II) ION × 2 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；12mg/mlATOX-Pt(DACH)(H2O)(SO4), 65% sat Li2SO4, 100mM MES, 60mM NaCl, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.239
4YDX Crystal structure of cisplatin bound to a human copper chaperone (monomer) - new refinement Deposited 2015-02-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–68（67 aa）	Not recorded	PT PLATINUM (II) ION × 1 SO4 SULFATE ION × 1 TCE 3,3',3''-phosphanetriyltripropanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；294 K；2M lithium sulfate, 0.1M MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.60 Å R-free 0.155
4YEA Crystal structure of cisplatin bound to a human copper chaperone (dimer) - new refinement Deposited 2015-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–68（67 aa） Chain B 2–68（67 aa）	Not recorded	CU COPPER (II) ION × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；294 K；1.5 M LITHIUM SULFATE, 0.1M MES, 50 MM NACL, PH 6, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 294K	Resolution 2.14 Å R-free 0.197
5F0W Crystal structure of human copper homeostatic proteins atox1 Deposited 2015-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	AG SILVER ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M tri-sodium citrate, 20 % (W/V) PEG 3350	Resolution 2.70 Å R-free 0.289
5F0W Crystal structure of human copper homeostatic proteins atox1 Deposited 2015-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–68（68 aa）	Not recorded	AG SILVER ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M tri-sodium citrate, 20 % (W/V) PEG 3350	Resolution 2.70 Å R-free 0.289
5F0W Crystal structure of human copper homeostatic proteins atox1 Deposited 2015-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–68（68 aa）	Not recorded	AG SILVER ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M tri-sodium citrate, 20 % (W/V) PEG 3350	Resolution 2.70 Å R-free 0.289
5F0W Crystal structure of human copper homeostatic proteins atox1 Deposited 2015-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–68（68 aa）	Not recorded	AG SILVER ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M tri-sodium citrate, 20 % (W/V) PEG 3350	Resolution 2.70 Å R-free 0.289
7DC1 Crystal structure of human copper homeostatic proteins atox1 Deposited 2020-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	AG SILVER ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M LiCl, 0.1M Tris pH8, 20% PEG6,000	Resolution 1.75 Å R-free 0.204
7DC1 Crystal structure of human copper homeostatic proteins atox1 Deposited 2020-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–68（68 aa）	Not recorded	AG SILVER ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2M LiCl, 0.1M Tris pH8, 20% PEG6,000	Resolution 1.75 Å R-free 0.204
7ZC3 Crystal structure of human copper chaperone Atox1 bound to zinc ion by CxxC motif Deposited 2022-03-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–68（68 aa） Chain B 1–68（68 aa）	Not recorded	ZN ZINC ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；Drop:12.5mg/ml Atox1 + 1.62mM ZnSO4 in 25mM Sodium Phosphate buffer pH 7.0, 2mM DTT; Reservoir: 1.9M Li2SO4, 100mM MES pH 6.0, 2.5% glycerol; VAPOR DIFFUSION, SITTING DROP, temperature 293K.	Resolution 1.90 Å R-free 0.186

16 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATOX1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–67； UniProt 2–68

Copper-transporting ATPase 1

Homo sapiens

UniProt Q04656

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 7–77	Fragment：UNP residues 7-77	Copper transport protein ATOX1 × 1 （O00244） PT PLATINUM (II) ION × 2 CU COPPER (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；PEG-6000 10 to 30 % w/v and sodium citrate 0.1M at pH 4.7	Resolution 2.83 Å R-free 0.273

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5T7L	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AW0 FOURTH METAL-BINDING DOMAIN OF THE MENKES COPPER-TRANSPORTING ATPASE, NMR, 20 STRUCTURES Deposited 1997-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 375–446（72 aa） Fragment：FOURTH METAL-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；300 K	Resolution not provided
1KVI Solution Structure of the Reduced Form of the First Heavy Metal Binding Motif of the Menkes Protein Deposited 2002-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–79（79 aa） Fragment：RESIDUES 1-79	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Pressure 1 NMR sample composition 20 mM NaAcetate buffer, 10 mM DTT, 1 mM EDTA, 0.01% Na Azide, 1 mM Protein \| H2O/D2O	Resolution not provided
1KVJ Solution Structure of the Cu(I) bound form of the first heavy metal binding motif of the Menkes protein Deposited 2002-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–79（79 aa） Fragment：RESIDUES 1-79	Not recorded	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 6.5；295 K；Pressure 1 NMR sample composition 20 mM Na Acetate buffer, 10 mM DTT, 1 mM EDTA, 0.01% Na Azide, 1 mM Protein \| H2O/D2O	Resolution not provided
1Q8L Second Metal Binding Domain of the Menkes ATPase Deposited 2003-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 164–246（83 aa） Fragment：Second Copper Binding Domain (residues 164-246)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 30mM；Pressure ambient NMR sample composition 0.5mM MNKr2, U-15N, 20mM potassium phosphate, 10 mM Sodium Chloride, pH6.5. \| 90% H2O/10% D2O	Resolution not provided
1S6O Solution structure and backbone dynamics of the apo-form of the second metal-binding domain of the Menkes protein ATP7A Deposited 2004-01-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 169–240（72 aa） Fragment：Second soluble domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) phosphate 100 mM；Pressure ambient NMR sample composition 1 mM protein, pH 7 \| 90% H2O/10% D2O NMR sample composition 1 mM protein U-15N, pH 7 \| 90% H2O/10% D2O NMR sample composition 1 mM protein U-15N,13C, pH 7 \| 90% H2O/10% D2O	Resolution not provided
1S6U Solution structure and backbone dynamics of the Cu(I) form of the second metal-binding domain of the Menkes protein ATP7A Deposited 2004-01-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 169–240（72 aa） Fragment：Second domain of ATP7A	Not recorded	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100 mM phosphate；Pressure ambient NMR sample composition 1 mM protein, 1:1 copper(I) \| 90% H2O/10% D2O NMR sample composition 1 mM protein U-15N, 1:1 copper(I) \| 90% H2O/10% D2O NMR sample composition 1 mM protein U-15N,13C, 1:1 copper(I) \| 90% H2O/10% D2O	Resolution not provided
1Y3J Solution structure of the copper(I) form of the fifth domain of Menkes protein Deposited 2004-11-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 486–558（73 aa） Fragment：fifth domain of the menkes protein	Not recorded	CU COPPER (II) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 50mM sodium phosphate；Pressure ambient NMR sample composition 1mM MNK5 domain U-15N,13C; 50mM phosphate buffer NA \| 90% H2O/10% D2O	Resolution not provided
1Y3K Solution structure of the apo form of the fifth domain of Menkes protein Deposited 2004-11-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 486–558（73 aa） Fragment：fifth domain of the menkes protein	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 50mM sodium phosphate；Pressure ambient NMR sample composition 1mM MNK5 domain U-15N,13C; 50mM phosphate buffer NA \| 90% H2O/10% D2O	Resolution not provided
1YJR Solution structure of the apo form of the sixth soluble domain A69P mutant of Menkes protein Deposited 2005-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 562–633（72 aa） Fragment：Sixth soluble domain	Mutation：A69P	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100 mM phosphate buffer；Pressure ambient NMR sample composition 0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O	Resolution not provided
1YJT Solution structure of the Cu(I) form of the sixth soluble domain A69P mutant of Menkes protein Deposited 2005-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 562–633（72 aa） Fragment：Sixth soluble domain	Mutation：A69P	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate buffer；Pressure ambient NMR sample composition 0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O	Resolution not provided
1YJU Solution structure of the apo form of the sixth soluble domain of Menkes protein Deposited 2005-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 562–633（72 aa） Fragment：Sixth soluble domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate buffer；Pressure ambient NMR sample composition 0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O	Resolution not provided
1YJV Solution structure of the Cu(I) form of the sixth soluble domain of Menkes protein Deposited 2005-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 562–633（72 aa） Fragment：Sixth soluble domain	Not recorded	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate buffer；Pressure ambient NMR sample composition 0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O NMR sample composition 1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer \| 90% H2O/10% D2O	Resolution not provided
2AW0 FOURTH METAL-BINDING DOMAIN OF THE MENKES COPPER-TRANSPORTING ATPASE, NMR, 20 STRUCTURES Deposited 1997-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 375–446（72 aa） Fragment：FOURTH METAL-BINDING DOMAIN	Not recorded	AG SILVER ION × 1	SOLUTION NMR NMR measurement conditions pH 6.8；300 K	Resolution not provided
2G9O Solution structure of the apo form of the third metal-binding domain of ATP7A protein (Menkes Disease protein) Deposited 2006-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 275–352（78 aa） Fragment：sixth soluble domain, residues 275-352	Mutation：K46V	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate buffer；Pressure ambient NMR sample composition 1.5mM Apo-MNK3 unlabelled sample, 100mM phosphate buffer, pH 7.0, 1mM DTT,90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM Apo-MNK3 15N labelled sample, 100mM phosphate buffer, pH 7.0, 1mM DTT, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1mM Apo-MNK3 15N, 13C labelled sample, 100mM phosphate buffer, pH 7.0, 1mM DTT, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2GA7 Solution structure of the copper(I) form of the third metal-binding domain of ATP7A protein (menkes disease protein) Deposited 2006-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 275–352（78 aa） Fragment：Third soluble domain, residues 275-352	Mutation：K46V	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate buffer；Pressure ambient NMR sample composition 1mM copper(I)MNK3 unlabelled sample, 100mM phosphate buffer, pH 7.0, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5mM copper(I)MNK3 15N labeled sample, 100mM phosphate buffer, pH 7.0, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5mM copper(I)MNK3 15N,13C labeled sample, 100mM phosphate buffer, pH 7.0, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2K1R The solution NMR structure of the complex between MNK1 and HAH1 mediated by Cu(I) Deposited 2008-03-14	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 5–77（73 aa） Fragment：HMA 1 domain: Residues 5-77	Not recorded	CU COPPER (II) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Pressure ambient NMR measurement conditions pH 7；298 K；Pressure ambient NMR measurement conditions pH 7；298 K；Pressure ambient NMR measurement conditions pH 7；298 K；Pressure ambient NMR sample composition 0.6 mM MNK1, 0.6 mM [U-100% 13C; U-100% 15N] HAH1, 0.6 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-100% 13C; U-100% 15N] MNK1, 0.6 mM HAH1, 0.6 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-100% 13C; U-100% 15N] MNK1, 1.0 mM HAH1, 1.0 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1.0 mM MNK1, 0.6 mM [U-100% 13C; U-100% 15N] HAH1, 1.0 mM COPPER(I) ION, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KIJ Solution structure of the Actuator domain of the copper-transporting ATPase ATP7A Deposited 2009-05-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 806–924（119 aa） Fragment：actuator domain, UNP residues 806-924	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) phosphate, arginine, glutamate；Pressure ambient NMR sample composition 0.3 mM Actd-1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3 mM [U-13C; U-15N] Actd-2, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3 mM [U-15N] Actd-3, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KMV Solution structure of the nucleotide binding domain of the human Menkes protein in the ATP-free form Deposited 2009-08-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1051–1231（181 aa） Fragment：nucleotide binding domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) phospate 0.05；Pressure ambient NMR sample composition 1.5 mM [U-99% 15N] ATPfree N-MNK-1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.8 mM [U-95% 13C; U-95% 15N] ATPfree N-MNK-2, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KMX Solution structure of the nucleotide binding domain of the human Menkes protein in the ATP-bound form Deposited 2009-08-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1051–1231（181 aa） Fragment：nucleotide binding domain	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) phospate 0.05；Pressure ambient NMR sample composition 1.5 mM [U-99% 15N] ATPfree N-MNK-1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.8 mM [U-95% 13C; U-95% 15N] ATPfree N-MNK-2, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3CJK Crystal structure of the adduct HAH1-Cd(II)-MNK1. Deposited 2008-03-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 7–77（71 aa）	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.7；298 K；0.1 M sodium citrate, 20% PEG-6000, pH 4.7, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.80 Å R-free 0.283
7LU8 Structure of the cryptic HMA domain of the human copper transporter ATP7A Deposited 2021-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 84–156（73 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 210；Pressure 1 NMR sample composition 0.35 mM [U-13C; U-15N] HMA2A, 50 mM HEPES, 150 mM sodium chloride, 5 mM TCEP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided

21 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATP7A_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–71； UniProt 7–77

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5t7l
Deposition date deposition_date	2016-09-05
Structure title title	Pt(II)-mediated copper-dependent interactions between ATOX1 and MNK1
Keywords keywords	Atox1-MNK1, Pt-binding, heterodimer, transport protein; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	17.20 Å
Radius of gyration Rg (electron density) rg_electron	16.54 Å
Forward intensity I(0) i0	5536520.00
Molecular weight molecular_weight	16171.0 kDa
Excluded volume excluded_volume	19745 Å³
Envelope volume envelope_volume	22753 Å³
Hydration-shell volume shell_volume	12360 Å³
Envelope diameter envelope_diameter	62.5 Å
Shell Rg shell_rg	21.24 Å
Envelope Rg envelope_rg	16.91 Å
Shape Rg shape_rg	16.53 Å
Total Rg total_rg	17.37 Å
Total atoms total_atoms	1097
Residues n_residues	143
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	61.9 Å
Rg (real space) rg_real	17.27 Å
Rg uncertainty (real space) rg_real_error	0.54 Å
I(0) (real space) i0_real	5.5370e+06
I(0) uncertainty (real space) i0_real_error	6.6860e+04
Rg (reciprocal space) rg_reciprocal	17.26 Å
I(0) (reciprocal space) i0_reciprocal	5537000.0000
Solution quality estimate total_estimate	0.5802
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	17.9 Å
Skewness Skewness skewness	0.456
Kurtosis Kurtosis kurtosis	-0.169
Angular range angular_range	— – 0.4650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	659100.0000
Real-space data points n_real_points	77
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.646; Stabil: 1.000; Sysdev: 0.257; Positv: 1.000; Valcen: 0.828; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Copper transport protein ATOX1
Molecular weight formula_weight	7394.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1138

PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEI

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Copper-transporting ATPase 1
Molecular weight formula_weight	8317.4 kDa
EC 编号 ec_number	3.6.3.54
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

VNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PLATINUM (II) ION
Molecular weight formula_weight	195.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	13

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d5t7la1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d5t7la2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5t7lb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d5t7lb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	5t7lA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	5t7lB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	47.617 Å
Unit-cell length b length_b	54.659 Å
Unit-cell length c length_c	63.719 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.830 Å
Low-resolution limit resolution_low	41.486 Å
R factor r_factor	0.2035
R_work r_work	0.2002
R_free r_free	0.2734

fit	/app/data/saxs_computation/t7/5t7l/5t7l.fit
pddf	/app/data/pr_computation/t7/5t7l/5t7l.pr.out
profile	/app/data/saxs_computation/t7/5t7l/5t7l.dat

Pt(II)-mediated copper-dependent interactions between ATOX1 and MNK1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Copper transport protein ATOX1

State in the Current Structure

Other States of the Same Protein in the Database

Copper-transporting ATPase 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)