SAXSdb — 5vay

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count
3	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count
4	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCL2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–36； UniProt 1–34 Author chain A； PDBConstruct 53–168； UniProt 92–207 Author chain B； PDBConstruct 3–36； UniProt 1–34 Author chain B； PDBConstruct 53–168； UniProt 92–207 Author chain C； PDBConstruct 3–36； UniProt 1–34 Author chain C； PDBConstruct 53–168； UniProt 92–207 Author chain D； PDBConstruct 3–36； UniProt 1–34 Author chain D； PDBConstruct 53–168； UniProt 92–207

Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera

Homo sapiens

UniProt Q07817

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count
3	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count
4	Insufficient information	Heteromer	Protein 2	Beclin-1 × 1 （Q14457） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2CL1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 37–52； UniProt 29–44 Author chain B； PDBConstruct 37–52； UniProt 29–44 Author chain C； PDBConstruct 37–52； UniProt 29–44 Author chain D； PDBConstruct 37–52； UniProt 29–44

Beclin-1

OrganismNot specified

UniProt Q14457

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera × 1 （P10415,Q07817） water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera × 1 （P10415,Q07817） water × 2	Consistent with protein count
3	Insufficient information	Heteromer	Protein 2	Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera × 1 （P10415,Q07817） water × 2	Consistent with protein count
4	Insufficient information	Heteromer	Protein 2	Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera × 1 （P10415,Q07817） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BECN1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–26； UniProt 105–130 Author chain F； PDBConstruct 1–26； UniProt 105–130 Author chain G； PDBConstruct 1–26； UniProt 105–130 Author chain H； PDBConstruct 1–26； UniProt 105–130

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5vay
Deposition date deposition_date	2017-03-28
Structure title title	Bcl-2 complex with Beclin 1 T108D BH3 domain
Keywords keywords	apoptosis, Bcl-2, autophagy, Beclin 1; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5vay__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5vay__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5vay__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.52 Å
Rg (electron density)	15.08 Å
Total Rg	16.28 Å
Atom count	1378
Residues	172
Excluded volume	24202 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5vay__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5vay__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5vay__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5vay__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera
Molecular weight formula_weight	19501.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	5762

GSMAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDDVEENRTEAPEGTESEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	Beclin-1
Molecular weight formula_weight	2859.2 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,F,H

DGGDMENLSRRLKVTGDLFDIMSGQT

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	256

▶

Unit-cell length a length_a	85.205 Å
Unit-cell length b length_b	53.192 Å
Unit-cell length c length_c	91.413 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.39 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.804 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1857
R_work r_work	0.1836
R_free r_free	0.2280

Bcl-2 complex with Beclin 1 T108D BH3 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera

State in the Current Structure

Other States of the Same Protein in the Database

Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera

State in the Current Structure

Other States of the Same Protein in the Database

Beclin-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5vay__assembly_1__model_1

5vay__assembly_1__model_1 | I(q)

5vay__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Bcl-2 complex with Beclin 1 T108D BH3 domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Apoptosis regulator Bcl-2 -- Bcl-2-like protein 1 Chimera

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Beclin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5vay__assembly_1__model_1

5vay__assembly_1__model_1 | I(q)

5vay__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)