SAXSdb — 5we0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protection of telomeres protein poz1

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein tpz1 × 1 （O14246） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein tpz1 × 1 （O14246） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein tpz1 × 1 （O14246） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein tpz1 × 1 （O14246） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POZ1_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–249； UniProt 2–249 Author chain D； PDBConstruct 2–249； UniProt 2–249 Author chain G； PDBConstruct 2–249； UniProt 2–249 Author chain J； PDBConstruct 2–249； UniProt 2–249

Protection of telomeres protein tpz1

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt O14246

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） DNA-binding protein rap1 × 1 （Q96TL7） ZINC ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TPZ1_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–33； UniProt 476–508 Author chain E； PDBConstruct 1–33； UniProt 476–508 Author chain H； PDBConstruct 1–33； UniProt 476–508 Author chain K； PDBConstruct 1–33； UniProt 476–508

DNA-binding protein rap1

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt Q96TL7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） Protection of telomeres protein tpz1 × 1 （O14246） ZINC ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） Protection of telomeres protein tpz1 × 1 （O14246） ZINC ION × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） Protection of telomeres protein tpz1 × 1 （O14246） ZINC ION × 1 water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Protection of telomeres protein poz1 × 1 （O13852） Protection of telomeres protein tpz1 × 1 （O14246） ZINC ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAP1_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–30； UniProt 467–496 Author chain F； PDBConstruct 1–30； UniProt 467–496 Author chain I； PDBConstruct 1–30； UniProt 467–496 Author chain L； PDBConstruct 1–30； UniProt 467–496

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5we0
Deposition date deposition_date	2017-07-06
Structure title title	Structural Basis for Shelterin Bridge Assembly
Keywords keywords	Telomere, Shelterin, Cooperativity, GENE REGULATION; GENE REGULATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5we0__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5we0__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5we0__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.94 Å
Rg (electron density)	19.83 Å
Total Rg	20.89 Å
Atom count	2197
Residues	264
Excluded volume	39240 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5we0__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5we0__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5we0__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5we0__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Protection of telomeres protein poz1
Molecular weight formula_weight	29695.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J
Atom count atom_count	9184

SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLDPSSFQNLPITQTQPDSQQILWEYSLISNALERLENIELERQNCMREDGLSKYTNSLLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREIVKMLTSNIN

Source Source

Source organism organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protection of telomeres protein tpz1
Molecular weight formula_weight	3964.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K

SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS

Source Source

Source organism organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	DNA-binding protein rap1
Molecular weight formula_weight	3343.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L

SDNIFVKPGEDLEIPLLSDYSDSENISEKS

Source Source

Source organism organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	317

▶

Unit-cell length a length_a	56.720 Å
Unit-cell length b length_b	82.010 Å
Unit-cell length c length_c	103.510 Å
Unit-cell angle α angle_alpha	89.99 °
Unit-cell angle β angle_beta	89.98 °
Unit-cell angle γ angle_gamma	73.96 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	62.705 Å
R factor r_factor	0.1994
R_work r_work	0.1986
R_free r_free	0.2279

Structural Basis for Shelterin Bridge Assembly

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protection of telomeres protein poz1

State in the Current Structure

Other States of the Same Protein in the Database

Protection of telomeres protein tpz1

State in the Current Structure

Other States of the Same Protein in the Database

DNA-binding protein rap1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5we0__assembly_4__model_1

5we0__assembly_4__model_1 | I(q)

5we0__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Structural Basis for Shelterin Bridge Assembly

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protection of telomeres protein poz1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protection of telomeres protein tpz1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-binding protein rap1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5we0__assembly_4__model_1

5we0__assembly_4__model_1 | I(q)

5we0__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)