SAXSdb — 6b03

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative zinc protease

Pectobacterium atrosepticum SCRI1043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Ferredoxin-2, chloroplastic × 2 （P16972） water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6D8U3_PECAS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–924； UniProt 1–924

Ferredoxin-2, chloroplastic

Arabidopsis thaliana

UniProt P16972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Putative zinc protease × 1 （Q6D8U3） water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FER2_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–93； UniProt 53–145 Author chain F； PDBConstruct 1–93； UniProt 53–145

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6b03
Deposition date deposition_date	2017-09-13
Structure title title	The crystal structure of the ferredoxin protease FusC in complex with its substrate plant ferredoxin
Keywords keywords	M16 Protease, Ferredoxin cleavage, Iron Acquisition, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6b03__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6b03__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6b03__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.69 Å
Rg (electron density)	31.80 Å
Total Rg	32.50 Å
Atom count	7475
Residues	944
Excluded volume	132520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6b03__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Putative zinc protease
Molecular weight formula_weight	104028.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7620

MNWKKCCWLSLTAVGLLAGSVVSQAEEIKSPLPVFKEGTLANGFRYTLVQLEGPKTRVDIRLIVDVGSIDEKDNESGVAHMVEHMVFRASDAFPQGVSTELHKQGWGRGQSYNAVTNYERTMYMMSPPKGNLDLGATLQALSQMTGHAKLLQSDLDDERKIILEEWRGKLGVAERMNQQRVQAIRHDSRYPSRPVIGTEESINDTPASVLQDFYQRWYHPSNMRLMIIGDITPADAEREIQRYFAALPNVAVPTRDYYEPLLKPQLKVARLQDSQSGSSQVSFVYRFNDKDAFGQSEYRHRLLTQITMSAVTRQVRRQKAELPQDASSLVVRKSDIGKTTAALGFFANVMPGGHDAAISAVLKEIERFKRYPLNEQDITEITSDIREVAQRMSVTPETREFADWVQQLTIVWQQDRPYVGSQQRGKDALEALDTIKGEDVNRHWQRWLASPDTLAQFSVPGATPFTLPKPDAISKLQKQWALATLAPLRLEEKKIIPELPSVTQSGKRTAVKTFAAQKVEQWQLSNGDRVVWLRAPEAGKKVYLTATSQAGFMATAMNPWQAQLASQLVNQSGPATWSGESLSNWKKEKTLSLSIDQEADQLTLSGTAPTEQLASLFGLYRELNVAPGIDPDVMKESMMSLARQKANDDQSVGGKRASEMTKLRFGEPAWQQPEIAELKKISAPALLSQWHKAASAPVTYYLIADMPATQLLPQVERYLATIPRQPASEVKQHLALSGKREATSAINVEPRADILTWSFTPHAWTPQAAVQVSIARNIASKYLKTSLRDDALGIYRMRVDSELEDKKQRIETEVSFTSAPERAQELWTLAEQAFSELPTKITQQDVDEQKAQFIRAEKGRQGDLTTIQRRLILSYRHYNDPRYLSNASKLADSITLESVRAMSAKLYNPDNRVLYITLPQEVKE

Source Source

Source organism organism	Pectobacterium atrosepticum SCRI1043
NCBI taxonomy ID ncbi_taxonomy_id	218491
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Ferredoxin-2, chloroplastic
Molecular weight formula_weight	11342.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,C

ATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEAIMLEHHHHHH

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	Mouse-ear cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	50

▶

Unit-cell length a length_a	82.578 Å
Unit-cell length b length_b	127.260 Å
Unit-cell length c length_c	133.205 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	41.289 Å
R factor r_factor	0.1981
R_work r_work	0.1957
R_free r_free	0.2427

The crystal structure of the ferredoxin protease FusC in complex with its substrate plant ferredoxin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative zinc protease

State in the Current Structure

Other States of the Same Protein in the Database

Ferredoxin-2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6b03__assembly_1__model_1

6b03__assembly_1__model_1 | I(q)

6b03__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

The crystal structure of the ferredoxin protease FusC in complex with its substrate plant ferredoxin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative zinc protease

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ferredoxin-2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6b03__assembly_1__model_1

6b03__assembly_1__model_1 | I(q)

6b03__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)