6byl

Structure of 14-3-3 gamma bound to O-GlcNAcylated thr peptide

Method: X-RAY DIFFRACTION D_max: 150.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

14-3-3 protein gamma

Homo sapiens

UniProt P61981

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 2–241 Chain D； UniProt 2–241	Not recorded	TSASTTVPVTTATTTTTSTW O-GlcNac peptide × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；29% PEG 4000, 200 mM sodium acetate, 0.1 M Tris pH 8.5	Resolution 3.35 Å R-free 0.285
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 2–241 Chain C； UniProt 2–241	Not recorded	TSASTTVPVTTATTTTTSTW O-GlcNac peptide × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；29% PEG 4000, 200 mM sodium acetate, 0.1 M Tris pH 8.5	Resolution 3.35 Å R-free 0.285
3	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 2–241 Chain F； UniProt 2–241	Not recorded	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；29% PEG 4000, 200 mM sodium acetate, 0.1 M Tris pH 8.5	Resolution 3.35 Å R-free 0.285

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6BYL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2B05 Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide Deposited 2005-09-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–246（246 aa） Chain D 1–246（246 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；PEG 3350, magnesium chloride, Bis-Tris, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.55 Å R-free 0.302
2B05 Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide Deposited 2005-09-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–246（246 aa） Chain C 1–246（246 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；PEG 3350, magnesium chloride, Bis-Tris, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.55 Å R-free 0.302
2B05 Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide Deposited 2005-09-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–246（246 aa） Chain F 1–246（246 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；PEG 3350, magnesium chloride, Bis-Tris, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.55 Å R-free 0.302
2B05 Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide Deposited 2005-09-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–246（246 aa） Chain B 1–246（246 aa） Chain C 1–246（246 aa） Chain D 1–246（246 aa） Chain E 1–246（246 aa） Chain F 1–246（246 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；PEG 3350, magnesium chloride, Bis-Tris, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.55 Å R-free 0.302
3UZD Crystal structure of 14-3-3 GAMMA Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–247（247 aa）	Not recorded	NO3 NITRATE ION × 12 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.3M Mg (OAc)2, 20% PEG3350, vapor diffusion, hanging drop, temperature 291K	Resolution 1.86 Å R-free 0.230
3UZD Crystal structure of 14-3-3 GAMMA Deposited 2011-12-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–247（247 aa）	Not recorded	NO3 NITRATE ION × 6 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.3M Mg (OAc)2, 20% PEG3350, vapor diffusion, hanging drop, temperature 291K	Resolution 1.86 Å R-free 0.230
3UZD Crystal structure of 14-3-3 GAMMA Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–247（247 aa）	Not recorded	NO3 NITRATE ION × 3 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.3M Mg (OAc)2, 20% PEG3350, vapor diffusion, hanging drop, temperature 291K	Resolution 1.86 Å R-free 0.230
4E2E Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG) from Homo sapiens at 2.25 A resolution Deposited 2012-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–247（247 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；1.00M LiCl, 20.00% PEG-6000, 0.1M HEPES pH 7.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.25 Å R-free 0.229
4E2E Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG) from Homo sapiens at 2.25 A resolution Deposited 2012-03-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–247（247 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；1.00M LiCl, 20.00% PEG-6000, 0.1M HEPES pH 7.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.25 Å R-free 0.229
4J6S 14-3-3gamma complexed with the N-terminal sequence of tyrosine hydroxylase (residues 1-43) Deposited 2013-02-11	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–247（247 aa） Chain B 1–247（247 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.1；283 K；30% PEG 2000 MME, 0.1M Potassium Thiocyanate, pH 7.1, VAPOR DIFFUSION, temperature 283.0K	Resolution 3.08 Å R-free 0.254
4J6S 14-3-3gamma complexed with the N-terminal sequence of tyrosine hydroxylase (residues 1-43) Deposited 2013-02-11	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–247（247 aa） Chain D 1–247（247 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.1；283 K；30% PEG 2000 MME, 0.1M Potassium Thiocyanate, pH 7.1, VAPOR DIFFUSION, temperature 283.0K	Resolution 3.08 Å R-free 0.254
4O46 14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228 Deposited 2013-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–247（247 aa）	Not recorded	UNX UNKNOWN LIGAND × 10	X-RAY DIFFRACTION X-ray crystallization conditions 291 K；20% PEG3350, 0.2 M magnesium nitrate, temperature 291K	Resolution 2.90 Å R-free 0.249
4O46 14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228 Deposited 2013-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–247（247 aa）	Not recorded	UNX UNKNOWN LIGAND × 18	X-RAY DIFFRACTION X-ray crystallization conditions 291 K；20% PEG3350, 0.2 M magnesium nitrate, temperature 291K	Resolution 2.90 Å R-free 0.249
4O46 14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228 Deposited 2013-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–247（247 aa）	Not recorded	UNX UNKNOWN LIGAND × 14	X-RAY DIFFRACTION X-ray crystallization conditions 291 K；20% PEG3350, 0.2 M magnesium nitrate, temperature 291K	Resolution 2.90 Å R-free 0.249
4O46 14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228 Deposited 2013-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–247（247 aa）	Not recorded	UNX UNKNOWN LIGAND × 9	X-RAY DIFFRACTION X-ray crystallization conditions 291 K；20% PEG3350, 0.2 M magnesium nitrate, temperature 291K	Resolution 2.90 Å R-free 0.249
4O46 14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228 Deposited 2013-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–247（247 aa）	Not recorded	UNX UNKNOWN LIGAND × 5	X-RAY DIFFRACTION X-ray crystallization conditions 291 K；20% PEG3350, 0.2 M magnesium nitrate, temperature 291K	Resolution 2.90 Å R-free 0.249
4O46 14-3-3-gamma in complex with influenza NS1 C-terminal tail phosphorylated at S228 Deposited 2013-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–247（247 aa）	Not recorded	UNX UNKNOWN LIGAND × 1	X-RAY DIFFRACTION X-ray crystallization conditions 291 K；20% PEG3350, 0.2 M magnesium nitrate, temperature 291K	Resolution 2.90 Å R-free 0.249
5D3E Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795 Deposited 2015-08-06	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–238（238 aa） Chain B 1–238（238 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；HEPES, NaCl, DTT, (NH4)2SO4, Poly(acrylic acid sodium salt 2100	Resolution 2.75 Å R-free 0.244
5D3E Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795 Deposited 2015-08-06	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1–238（238 aa） Chain F 1–238（238 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；HEPES, NaCl, DTT, (NH4)2SO4, Poly(acrylic acid sodium salt 2100	Resolution 2.75 Å R-free 0.244
5D3E Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795 Deposited 2015-08-06	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 1–238（238 aa） Chain J 1–238（238 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；HEPES, NaCl, DTT, (NH4)2SO4, Poly(acrylic acid sodium salt 2100	Resolution 2.75 Å R-free 0.244
6A5S Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Deposited 2018-06-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–247（247 aa） Chain B 1–247（247 aa）	Not recorded	NA SODIUM ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.3；289 K；0.1 M Tris-HCl, 0.2 M calcium acetate, and 20% (w/v) PEG 3350	Resolution 2.10 Å R-free 0.227
6A5S Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Deposited 2018-06-25	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 1–247（247 aa） Chain G 1–247（247 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.3；289 K；0.1 M Tris-HCl, 0.2 M calcium acetate, and 20% (w/v) PEG 3350	Resolution 2.10 Å R-free 0.227
6BYJ Structure of human 14-3-3 gamma bound to O-GlcNAc peptide Deposited 2017-12-20	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2–241（240 aa） Chain D 2–241（240 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；29% PEG 4000, 200 mM sodium acetate, 0.1 M Tris pH 8.5	Resolution 2.90 Å R-free 0.269
6BYJ Structure of human 14-3-3 gamma bound to O-GlcNAc peptide Deposited 2017-12-20	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 2–241（240 aa） Chain C 2–241（240 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；29% PEG 4000, 200 mM sodium acetate, 0.1 M Tris pH 8.5	Resolution 2.90 Å R-free 0.269
6BYJ Structure of human 14-3-3 gamma bound to O-GlcNAc peptide Deposited 2017-12-20	Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 2–241（240 aa） Chain F 2–241（240 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；29% PEG 4000, 200 mM sodium acetate, 0.1 M Tris pH 8.5	Resolution 2.90 Å R-free 0.269
6BZD Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide Deposited 2017-12-22	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2–247（246 aa） Chain B 2–247（246 aa）	Mutation：R57E Mutation：R57E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；25% PEG 4000, 0.2 M MgCl2, 0.1 M Tris pH 8.5, 20% glycerol	Resolution 2.67 Å R-free 0.281
6BZD Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide Deposited 2017-12-22	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 2–247（246 aa） Chain D 2–247（246 aa）	Mutation：R57E Mutation：R57E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；25% PEG 4000, 0.2 M MgCl2, 0.1 M Tris pH 8.5, 20% glycerol	Resolution 2.67 Å R-free 0.281
6FEL Structure of 14-3-3 gamma in complex with CaMKK2 14-3-3 binding motif Ser511 Deposited 2018-01-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain B 1–234（234 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；291.15 K；sodium citrate, potassium sodium tartrate, and ammonium sulfate	Resolution 2.84 Å R-free 0.280
6FEL Structure of 14-3-3 gamma in complex with CaMKK2 14-3-3 binding motif Ser511 Deposited 2018-01-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–234（234 aa） Chain D 1–234（234 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；291.15 K；sodium citrate, potassium sodium tartrate, and ammonium sulfate	Resolution 2.84 Å R-free 0.280
6GKF Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain B 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；PEG 4000, TRIS-HCl, sodium acetate	Resolution 2.60 Å R-free 0.289
6GKF Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–234（234 aa） Chain D 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；PEG 4000, TRIS-HCl, sodium acetate	Resolution 2.60 Å R-free 0.289
6GKF Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–234（234 aa） Chain F 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；PEG 4000, TRIS-HCl, sodium acetate	Resolution 2.60 Å R-free 0.289
6GKF Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 1–234（234 aa） Chain H 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；PEG 4000, TRIS-HCl, sodium acetate	Resolution 2.60 Å R-free 0.289
6GKG Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser164 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain E 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；Tris-HCl, PEG 4000, lithium sulfate	Resolution 2.85 Å R-free 0.287
6GKG Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser164 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–234（234 aa） Chain F 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；Tris-HCl, PEG 4000, lithium sulfate	Resolution 2.85 Å R-free 0.287
6GKG Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser164 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–234（234 aa） Chain G 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；Tris-HCl, PEG 4000, lithium sulfate	Resolution 2.85 Å R-free 0.287
6GKG Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser164 Deposited 2018-05-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain D 1–234（234 aa） Chain H 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293.15 K；Tris-HCl, PEG 4000, lithium sulfate	Resolution 2.85 Å R-free 0.287
6S9K Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding motif Ser139 and NLS Deposited 2019-07-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa）	Mutation：none	CFH 1,1,1,3,3,3-hexafluoropropan-2-ol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293.15 K；PEG 400, calcium chloride, HEPES, 1,1,1,3,3,3-hexafluoropropan-2-ol	Resolution 1.60 Å R-free 0.221
6SAD Structure of 14-3-3 gamma in complex with double phosphorylated caspase-2 peptide on Ser139 and Ser164 Deposited 2019-07-16	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–234（234 aa） Chain B 1–234（234 aa）	Mutation：none Mutation：none	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293.15 K；PEG 400, magnesium chloride, HEPES, 1,1,1,3,3,3-hexafluoropropan-2-ol	Resolution 2.75 Å R-free 0.271
6Y4K Crystal structure of human 14-3-3 gamma in complex with CaMKK2 14-3-3 binding motif Ser100 and Fusicoccin A Deposited 2020-02-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain B 1–234（234 aa）	Not recorded	FSC FUSICOCCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；PEG400, HEPES, magnesium chloride, hexafluoropropanol	Resolution 3.00 Å R-free 0.292
6Y6B Crystal structure of human 14-3-3 gamma in complex with CaMKK2 14-3-3 binding motif Ser100 and 16-OMe-Fusicoccin H Deposited 2020-02-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain B 1–234（234 aa）	Not recorded	OD8 (2~{R},3~{S},4~{S},5~{R},6~{S})-2-(hydroxymethyl)-6-[[(1~{S},3~{R},6~{S},7~{S},8~{R},9~{R},10~{R},11~{R},14~{S})-14-(me thoxymethyl)-3,10-dimethyl-9-oxidanyl-6-propan-2-yl-8-tricyclo[9.3.0.0^{3,7}]tetradecanyl]oxy]oxane-3,4,5-triol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；PEG400, HEPES, magnesium chloride, hexafluoropropanol	Resolution 3.08 Å R-free 0.282
6ZBT Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342 Deposited 2020-06-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain B 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	CFH 1,1,1,3,3,3-hexafluoropropan-2-ol × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293.15 K；PEG 400, magnesium chloride, HEPES, hexafluoro-2-propanol	Resolution 1.80 Å R-free 0.241
6ZBT Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342 Deposited 2020-06-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–234（234 aa） Chain D 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	CFH 1,1,1,3,3,3-hexafluoropropan-2-ol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293.15 K；PEG 400, magnesium chloride, HEPES, hexafluoro-2-propanol	Resolution 1.80 Å R-free 0.241
6ZC9 Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448 Deposited 2020-06-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain C 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293.15 K；PEG 400, magnesium chloride, HEPES, hexafluoro-2-propanol	Resolution 1.90 Å R-free 0.239
6ZC9 Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448 Deposited 2020-06-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–234（234 aa） Chain D 1–234（234 aa）	Mutation：S235Stop Mutation：S235Stop	CFH 1,1,1,3,3,3-hexafluoropropan-2-ol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293.15 K；PEG 400, magnesium chloride, HEPES, hexafluoro-2-propanol	Resolution 1.90 Å R-free 0.239
7A6R Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding motif Deposited 2020-08-26	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain C 1–234（234 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；290.15 K；HEPES, MgCl2, PEG400, hexafluoro-2-propanol	Resolution 2.70 Å R-free 0.275
7A6R Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding motif Deposited 2020-08-26	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–234（234 aa） Chain D 1–234（234 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；290.15 K；HEPES, MgCl2, PEG400, hexafluoro-2-propanol	Resolution 2.70 Å R-free 0.275
7A6Y Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A Deposited 2020-08-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–234（234 aa） Chain C 1–234（234 aa）	Not recorded	FSC FUSICOCCIN × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；290.15 K；HEPES, MgCl2, PEG400, hexafluoro-2-propanol, FC-A	Resolution 2.50 Å R-free 0.259
7A6Y Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A Deposited 2020-08-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–234（234 aa） Chain D 1–234（234 aa）	Not recorded	FSC FUSICOCCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；290.15 K；HEPES, MgCl2, PEG400, hexafluoro-2-propanol, FC-A	Resolution 2.50 Å R-free 0.259
9CI3 Structure of the LRRK2/14-3-3 complex Deposited 2024-07-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–247（247 aa） Chain C 1–247（247 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.96 Å

21 other PDB entries and 50 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	1433G_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–240； UniProt 2–241 Author chain B； PDBConstruct 1–240； UniProt 2–241 Author chain C； PDBConstruct 1–240； UniProt 2–241 Author chain D； PDBConstruct 1–240； UniProt 2–241 Author chain E； PDBConstruct 1–240； UniProt 2–241 Author chain F； PDBConstruct 1–240； UniProt 2–241

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6byl
Deposition date deposition_date	2017-12-20
Structure title title	Structure of 14-3-3 gamma bound to O-GlcNAcylated thr peptide
Keywords keywords	14-3-3, O-glcNAc, PEPTIDE BINDING PROTEIN; PEPTIDE BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	46.01 Å
Radius of gyration Rg (electron density) rg_electron	45.87 Å
Forward intensity I(0) i0	433612000.00
Molecular weight molecular_weight	166440.0 kDa
Excluded volume excluded_volume	206440 Å³
Envelope volume envelope_volume	318460 Å³
Hydration-shell volume shell_volume	59806 Å³
Envelope diameter envelope_diameter	154.7 Å
Shell Rg shell_rg	48.96 Å
Envelope Rg envelope_rg	44.38 Å
Shape Rg shape_rg	45.89 Å
Total Rg total_rg	45.98 Å
Total atoms total_atoms	12854
Residues n_residues	1447
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	150.8 Å
Rg (real space) rg_real	46.13 Å
Rg uncertainty (real space) rg_real_error	1.52 Å
I(0) (real space) i0_real	4.3360e+08
I(0) uncertainty (real space) i0_real_error	7.9820e+06
Rg (reciprocal space) rg_reciprocal	46.01 Å
I(0) (reciprocal space) i0_reciprocal	433500000.0000
Solution quality estimate total_estimate	0.8639
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	48.8 Å
Skewness Skewness skewness	0.320
Kurtosis Kurtosis kurtosis	-0.575
Angular range angular_range	— – 0.1700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	22190000.0000
Real-space data points n_real_points	35
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.896; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.547

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	14-3-3 protein gamma
Molecular weight formula_weight	27676.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	12854

VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	TSASTTVPVTTATTTTTSTW O-GlcNac peptide
Molecular weight formula_weight	2015.1 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,P,T

TSASTTVPVTTATTTTTSTW

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	6bylA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	6bylB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	6bylC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	6bylD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	6bylE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

Domain ID domain_id	6bylF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	190 — Delta-Endotoxin; domain 1
Homologous superfamily homologous superfamily	20 — 14-3-3 domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	121.200 Å
Unit-cell length b length_b	121.200 Å
Unit-cell length c length_c	310.900 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	112.923 Å
R factor r_factor	0.2370
R_work r_work	0.2338
R_free r_free	0.2848

fit	/app/data/saxs_computation/by/6byl/6byl.fit
pddf	/app/data/pr_computation/by/6byl/6byl.pr.out
profile	/app/data/saxs_computation/by/6byl/6byl.dat

Structure of 14-3-3 gamma bound to O-GlcNAcylated thr peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

14-3-3 protein gamma

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)