6epf

Ground state 26S proteasome (GS1)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-6

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–246； UniProt 1–246

Proteasome subunit alpha type-2

OrganismNot specified

UniProt P17220

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

OrganismNot specified

UniProt P21670

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_RAT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit alpha type-7

OrganismNot specified

UniProt P48004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_RAT
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–254； UniProt 1–254

Proteasome subunit alpha type-5

OrganismNot specified

UniProt P34064

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_RAT
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit alpha type-1

OrganismNot specified

UniProt P18420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_RAT
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit alpha type-3

OrganismNot specified

UniProt P18422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_RAT
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–255； UniProt 1–255

Proteasome subunit beta type-6

OrganismNot specified

UniProt P28073

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_RAT
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 1； PDBConstruct 1–238； UniProt 1–238

Proteasome subunit beta type-7

OrganismNot specified

UniProt Q9JHW0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_RAT
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 2； PDBConstruct 1–277； UniProt 1–277

Proteasome subunit beta type-3

OrganismNot specified

UniProt P40112

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_RAT
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 3； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta type-2

OrganismNot specified

UniProt P40307

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_RAT
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 4； PDBConstruct 1–201； UniProt 1–201

Proteasome subunit beta type-5

OrganismNot specified

UniProt P28075

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_RAT
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 5； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit beta type-1

OrganismNot specified

UniProt P18421

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_RAT
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 6； PDBConstruct 1–240； UniProt 1–240

Proteasome subunit beta type-4

OrganismNot specified

UniProt P34067

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_RAT
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 7； PDBConstruct 1–263； UniProt 1–263

26S proteasome subunit S5a

OrganismNot specified

UniProt Q9ESH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9ESH1_RAT
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 1–377； UniProt 1–377

Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14

OrganismNot specified

UniProt Q4V8E2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4V8E2_RAT
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain V； PDBConstruct 1–310； UniProt 1–310

Proteasome 26S subunit, non-ATPase 8

OrganismNot specified

UniProt F1LMQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1LMQ3_RAT
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–353； UniProt 1–353

RCG28037

OrganismNot specified

UniProt D3ZHW9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D3ZHW9_RAT
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Y； PDBConstruct 1–70； UniProt 1–70

26S proteasome non-ATPase regulatory subunit 2

OrganismNot specified

UniProt Q4FZT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD2_RAT
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Z； PDBConstruct 1–908； UniProt 1–908

26S proteasome non-ATPase regulatory subunit 1

OrganismNot specified

UniProt O88761

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD1_RAT
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain N； PDBConstruct 1–953； UniProt 1–953

Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3

OrganismNot specified

UniProt Q5U2S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5U2S7_RAT
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain S； PDBConstruct 1–530； UniProt 1–530

Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12

OrganismNot specified

UniProt Q5XIC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5XIC6_RAT
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain P； PDBConstruct 1–456； UniProt 1–456

26S proteasome non-ATPase regulatory subunit 11

OrganismNot specified

UniProt F1LMZ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD11_RAT
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Q； PDBConstruct 1–422； UniProt 1–422

Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6

OrganismNot specified

UniProt Q6PCT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6PCT9_RAT
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain R； PDBConstruct 1–389； UniProt 1–389

Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted)

OrganismNot specified

UniProt D4AEH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D4AEH3_RAT
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain U； PDBConstruct 1–320； UniProt 1–320

26S proteasome non-ATPase regulatory subunit 13

OrganismNot specified

UniProt B0BN93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD13_RAT
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain O； PDBConstruct 1–376； UniProt 1–376

26S proteasome regulatory subunit 7

OrganismNot specified

UniProt Q63347

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_RAT
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain H； PDBConstruct 1–433； UniProt 1–433

26S proteasome regulatory subunit 4

OrganismNot specified

UniProt P62193

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_RAT
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain I； PDBConstruct 1–440； UniProt 1–440

26S proteasome regulatory subunit 6B

OrganismNot specified

UniProt Q63570

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_RAT
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain K； PDBConstruct 1–418； UniProt 1–418

Proteasome 26S subunit, ATPase 6

OrganismNot specified

UniProt G3V6W6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G3V6W6_RAT
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain L； PDBConstruct 1–403； UniProt 1–403

26S proteasome regulatory subunit 6A

OrganismNot specified

UniProt Q6P6U2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 8 × 1 （P62198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6P6U2_RAT
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain M； PDBConstruct 1–442； UniProt 1–442

26S proteasome regulatory subunit 8

OrganismNot specified

UniProt P62198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	Proteasome subunit alpha type-6 × 1 （P60901） Proteasome subunit alpha type-2 × 1 （P17220） Proteasome subunit alpha type-4 × 1 （P21670） Proteasome subunit alpha type-7 × 1 （P48004） Proteasome subunit alpha type-5 × 1 （P34064） Proteasome subunit alpha type-1 × 1 （P18420） Proteasome subunit alpha type-3 × 1 （P18422） Proteasome subunit beta type-6 × 1 （P28073） Proteasome subunit beta type-7 × 1 （Q9JHW0） Proteasome subunit beta type-3 × 1 （P40112） Proteasome subunit beta type-2 × 1 （P40307） Proteasome subunit beta type-5 × 1 （P28075） Proteasome subunit beta type-1 × 1 （P18421） Proteasome subunit beta type-4 × 1 （P34067） 26S proteasome subunit S5a × 1 （Q9ESH1） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 × 1 （Q4V8E2） Proteasome 26S subunit, non-ATPase 8 × 1 （F1LMQ3） RCG28037 × 1 （D3ZHW9） 26S proteasome non-ATPase regulatory subunit 2 × 1 （Q4FZT9） 26S proteasome non-ATPase regulatory subunit 1 × 1 （O88761） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3 × 1 （Q5U2S7） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12 × 1 （Q5XIC6） 26S proteasome non-ATPase regulatory subunit 11 × 1 （F1LMZ8） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6 × 1 （Q6PCT9） Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted) × 1 （D4AEH3） 26S proteasome non-ATPase regulatory subunit 13 × 1 （B0BN93） 26S proteasome regulatory subunit 7 × 1 （Q63347） 26S proteasome regulatory subunit 4 × 1 （P62193） 26S proteasome regulatory subunit 6B × 1 （Q63570） Proteasome 26S subunit, ATPase 6 × 1 （G3V6W6） 26S proteasome regulatory subunit 6A × 1 （Q6P6U2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_RAT
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain J； PDBConstruct 1–406； UniProt 1–406

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6epf
Deposition date deposition_date	2017-10-11
Structure title title	Ground state 26S proteasome (GS1)
Keywords keywords	UPS, Ground state, Neuron degeneration, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6epf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6epf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6epf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.89 Å
Rg (electron density)	76.78 Å
Total Rg	76.74 Å
Atom count	82757
Residues	10504
Excluded volume	1479900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6epf__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27432.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	82757

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25955.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29539.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQREKDK

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	28369.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAVVASVSGLTADARIVINRARVECQSHRLTVGDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILSPEEIEKYVAEIEKEKEENEKKKQKKAS

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26416.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEGHKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSTTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29557.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMQCNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAADEPAEKADEPMEH

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28456.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYAKESLKEEDESDDDNM

Entity 8 Entity 8 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	25309.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MAAALAVRGAVSAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	29963.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MAAVSVFQAPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGTRFGRYRCEKGTTAVLTEKVTPLELEVLEEIVQTMDTS

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22988.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MSVMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22941.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENITFTKRSS

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	28615.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYTSSIP

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	26511.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MLSTAAYRDPDRELVMGPQGSAGPVQMRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	29226.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MEAFWESRTGHWAGGPAPGQFYRVPSTPSCLMDPMSAPARPITRTQNPMVTGTSVLGVKFDCGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELFGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTKVIGGYAGGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQVATVTEKGVEIEGPLSAQTNWDIAHMISGFE

Entity 15 Entity 15 polymer

Description description	26S proteasome subunit S5a
Molecular weight formula_weight	40775.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEDSDDALLKMTISQQEFGRAGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESGDIDASSAMDTSEPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEEKK

Entity 16 Entity 16 polymer

Description description	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14
Molecular weight formula_weight	34620.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Entity 17 Entity 17 polymer

Description description	Proteasome 26S subunit, non-ATPase 8
Molecular weight formula_weight	39932.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MFIKGRTAKAPRGEPRRSSRRGQKLAVVAPPPALGSTSRPHFRRESIARRRCRKSGRLFAASRKMAAAAATVNGTTGVSSSGPAATSGGILQAAAGMYEQLKDEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWLLGPNNYYSFASQQQKPEDSTIPSTELARQVIEYARQLEMIV

Entity 18 Entity 18 polymer

Description description	RCG28037
Molecular weight formula_weight	8284.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Entity 19 Entity 19 polymer

Description description	26S proteasome non-ATPase regulatory subunit 2
Molecular weight formula_weight	100300.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MEEGGRDKTPVQSQQPSATAPSGADEKSSGKERRDAGEKDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKCFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKAQREPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYSKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYNL

Entity 20 Entity 20 polymer

Description description	26S proteasome non-ATPase regulatory subunit 1
Molecular weight formula_weight	105870.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDTQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGPEKDSDSMETEEKTAGAVAGKTPDASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNTQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGVCCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCIIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLSMTETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD

Entity 21 Entity 21 polymer

Description description	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 3
Molecular weight formula_weight	60778.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MKQEGSARRRGADKAKPPPGGEQEPPPPAPQDVEMKEEAAAGSGSAGEGDGKAAATEHSQRELDTVTLEDIKEHVRQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASAPLLPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Entity 22 Entity 22 polymer

Description description	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12
Molecular weight formula_weight	53011.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPVKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDNEQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDVFSSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGVINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

Entity 23 Entity 23 polymer

Description description	26S proteasome non-ATPase regulatory subunit 11
Molecular weight formula_weight	47526.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT

Entity 24 Entity 24 polymer

Description description	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6
Molecular weight formula_weight	45658.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDTAVREELMAAVRENNMAPYYEALCKSLDWQMDMDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

Entity 25 Entity 25 polymer

Description description	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 7 (Predicted)
Molecular weight formula_weight	36551.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKEEKKEKK

Entity 26 Entity 26 polymer

Description description	26S proteasome non-ATPase regulatory subunit 13
Molecular weight formula_weight	42867.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MKDVPAFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQATKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGDVDRFQTLKSAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLELWCTDVKSMELLVEHQAQDILT

Entity 27 Entity 27 polymer

Description description	26S proteasome regulatory subunit 7
Molecular weight formula_weight	48640.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIPVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN

Entity 28 Entity 28 polymer

Description description	26S proteasome regulatory subunit 4
Molecular weight formula_weight	49260.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL

Entity 29 Entity 29 polymer

Description description	26S proteasome regulatory subunit 6B
Molecular weight formula_weight	47468.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

Entity 30 Entity 30 polymer

Description description	Proteasome 26S subunit, ATPase 6
Molecular weight formula_weight	45867.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MALPGIPYERRLLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

Entity 31 Entity 31 polymer

Description description	26S proteasome regulatory subunit 6A
Molecular weight formula_weight	49611.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA

Entity 32 Entity 32 polymer

Description description	26S proteasome regulatory subunit 8
Molecular weight formula_weight	45694.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	11.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	7393

Ground state 26S proteasome (GS1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer