SAXSdb — 6f9w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein LSM14 homolog A

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Eukaryotic translation initiation factor 4E transporter × 2 （Q9NRA8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LS14A_HUMAN
Isoform	Q8ND56-3
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–87； UniProt 1–84

Eukaryotic translation initiation factor 4E transporter

Homo sapiens

UniProt Q9NRA8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein LSM14 homolog A × 2 （Q8ND56）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	4ET_HUMAN
Isoform	Q9NRA8-3
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 6–37； UniProt 955–986

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6f9w
Deposition date deposition_date	2017-12-15
Structure title title	Crystal structure of the LSM domain of LSM14 in complex with a C-terminal peptide of 4E-T
Keywords keywords	mRNA turnover, translational repression, decapping, RNA; RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6f9w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6f9w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6f9w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.69 Å
Rg (electron density)	19.74 Å
Total Rg	20.54 Å
Atom count	3382
Residues	208
Excluded volume	30376 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6f9w__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Protein LSM14 homolog A
Molecular weight formula_weight	9674.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1691

SNAMSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Eukaryotic translation initiation factor 4E transporter
Molecular weight formula_weight	4143.4 kDa
Mutation mutation	V963M
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GPLGSGLAKWFGSDMLQQPLPSMPAKVISVDELEYRQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d6f9wa_
Class class	b — All beta proteins
Fold Fold fold	b.38 — Sm-like fold
Superfamily Superfamily superfamily	b.38.1 — Sm-like ribonucleoproteins
Family Family family	b.38.1.5 — LSM14 N-terminal domain-like

CATH v4.4 (1 domains)

Domain ID domain_id	6f9wA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	100 —

▶

Unit-cell length a length_a	64.890 Å
Unit-cell length b length_b	64.890 Å
Unit-cell length c length_c	61.670 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	—

Resolution resolution	2.623 Å
Low-resolution limit resolution_low	45.884 Å
R factor r_factor	0.2218
R_work r_work	0.2205
R_free r_free	0.2453

Crystal structure of the LSM domain of LSM14 in complex with a C-terminal peptide of 4E-T

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein LSM14 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Eukaryotic translation initiation factor 4E transporter

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6f9w__assembly_1__model_1

6f9w__assembly_1__model_1 | I(q)

6f9w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of the LSM domain of LSM14 in complex with a C-terminal peptide of 4E-T

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein LSM14 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Eukaryotic translation initiation factor 4E transporter

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6f9w__assembly_1__model_1

6f9w__assembly_1__model_1 | I(q)

6f9w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)