SAXSdb — 6g26

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HicB

Burkholderia pseudomallei K96243

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HicA × 4 （Q63NA6） SULFATE ION × 5 1,2-ETHANEDIOL × 18 TRIETHYLENE GLYCOL × 1 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q63NA5_BURPS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–138； UniProt 1–137 Author chain B； PDBConstruct 2–138； UniProt 1–137 Author chain C； PDBConstruct 2–138； UniProt 1–137 Author chain D； PDBConstruct 2–138； UniProt 1–137

HicA

Burkholderia pseudomallei K96243

UniProt Q63NA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	HicB × 4 （Q63NA5） SULFATE ION × 5 1,2-ETHANEDIOL × 18 TRIETHYLENE GLYCOL × 1 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q63NA6_BURPS
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 7–64； UniProt 2–59 Author chain F； PDBConstruct 7–64； UniProt 2–59 Author chain G； PDBConstruct 7–64； UniProt 2–59 Author chain H； PDBConstruct 7–64； UniProt 2–59

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6g26
Deposition date deposition_date	2018-03-22
Structure title title	The crystal structure of the Burkholderia pseudomallei HicAB complex
Keywords keywords	N-terminal domain of the antitoxin HicB which acts as an inhibitor to HicA, ANTITOXIN; ANTITOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6g26__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6g26__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6g26__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.58 Å
Rg (electron density)	32.67 Å
Total Rg	33.30 Å
Atom count	6196
Residues	786
Excluded volume	110720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6g26__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	HicB
Molecular weight formula_weight	15762.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	6648

MMEFPIAVHKDDGSVYGVTVPDIPGVHSWGETIDDAIKNTREAIVGHVETLIELGEDVEFTCSTVEELVAKPEYAGAVWALVSVDLSQLDSKPERINVSIPRFVLHKIDAYVASRHETRSGFLARAALEALNEGKKHHHHHH

Source Source

Source organism organism	Burkholderia pseudomallei K96243
NCBI taxonomy ID ncbi_taxonomy_id	272560
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	HicA
Molecular weight formula_weight	7067.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

GIDPFTNSSKLIRMLEEDGWRLVRVTGSAHHFKHPKKPGLVTVPHPKKDLPIGTVKSIQKSAGL

Source Source

Source organism organism	Burkholderia pseudomallei K96243
NCBI taxonomy ID ncbi_taxonomy_id	272560
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 5 Entity 5 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	269

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6g26E00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	920 — Metal Transport, Frataxin; Chain A
Homologous superfamily homologous superfamily	30 — Hypothetical protein.

Domain ID domain_id	6g26F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	920 — Metal Transport, Frataxin; Chain A
Homologous superfamily homologous superfamily	30 — Hypothetical protein.

Domain ID domain_id	6g26G00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	920 — Metal Transport, Frataxin; Chain A
Homologous superfamily homologous superfamily	30 — Hypothetical protein.

Domain ID domain_id	6g26H00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	920 — Metal Transport, Frataxin; Chain A
Homologous superfamily homologous superfamily	30 — Hypothetical protein.

▶

Unit-cell length a length_a	85.140 Å
Unit-cell length b length_b	74.190 Å
Unit-cell length c length_c	85.310 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.05 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.490 Å
Low-resolution limit resolution_low	34.020 Å
R factor r_factor	0.1890
R_work r_work	0.1869
R_free r_free	0.2325

The crystal structure of the Burkholderia pseudomallei HicAB complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

HicB

State in the Current Structure

Other States of the Same Protein in the Database

HicA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6g26__assembly_1__model_1

6g26__assembly_1__model_1 | I(q)

6g26__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

The crystal structure of the Burkholderia pseudomallei HicAB complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

HicB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HicA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6g26__assembly_1__model_1

6g26__assembly_1__model_1 | I(q)

6g26__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)