SAXSdb — 6imf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cysteine-rich venom protein triflin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Small serum protein 2 × 1 （A7VN14） 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CRVP_PROFL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–221； UniProt 20–240

Small serum protein 2

OrganismNot specified

UniProt A7VN14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Cysteine-rich venom protein triflin × 1 （Q8JI39） 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GLYCEROL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MSMB2_PROFL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–109； UniProt 1–109

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6imf
Deposition date deposition_date	2018-10-22
Structure title title	Crystal structure of TOXIN/ANTITOXIN complex
Keywords keywords	COMPLEX, ANTITOXIN, TOXIN-ANTITOXIN COMPLEX, TOXIN; TOXIN/ANTITOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6imf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6imf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6imf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.74 Å
Rg (electron density)	19.84 Å
Total Rg	20.80 Å
Atom count	2338
Residues	295
Excluded volume	41061 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6imf__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Cysteine-rich venom protein triflin
Molecular weight formula_weight	24826.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2429

NVDFDSESPRKPEIQNEIIDLHNSLRRSVNPTASNMLKMEWYPEAAANAERWAYRCIESHSSRDSRVIGGIKCGENIYMATYPAKWTDIIHAWHGEYKDFKYGVGAVPSDAVIGHYTQIVWYKSYRAGCAAAYCPSSKYSYFYVCQYCPAGNIIGKTATPYKSGPPCGDCPSDCDNGLCTNPCTRENEFTNCDSLVQKSSCQDNYMKSKCPASCFCQNKII

Entity 2 Entity 2 polymer

Description description	Small serum protein 2
Molecular weight formula_weight	12140.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MRVFFSLIIFSFMLATCQGACGIGPLVSSPTDAMAPKKCVDPNDRRKHLIVSTWNTADCLRCECDNDGLSCCHRYGGLAERAGCKSVLNQVTCEYEFYRLDDLSKRCDA

Entity 3 Entity 3 non-polymer

Description description	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Molecular weight formula_weight	195.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	84

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6imfa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.111 — PR-1-like
Superfamily Superfamily superfamily	d.111.1 — PR-1-like
Family Family family	d.111.1.1 — PR-1-like

Domain ID domain_id	d6imfa2
Class class	g — Small proteins
Fold Fold fold	g.19 — Crisp domain-like
Superfamily Superfamily superfamily	g.19.1 — Crisp domain-like
Family Family family	g.19.1.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	6imfA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	33 — Pathogenesis-related Protein p14a
Homologous superfamily homologous superfamily	10 — CAP

Domain ID domain_id	6imfA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	740 — Crisp domain

▶

Unit-cell length a length_a	111.166 Å
Unit-cell length b length_b	48.113 Å
Unit-cell length c length_c	75.028 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	102.61 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	39.640 Å
R factor r_factor	0.1870
R_work r_work	0.1860
R_free r_free	0.2190

Crystal structure of TOXIN/ANTITOXIN complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cysteine-rich venom protein triflin

State in the Current Structure

Other States of the Same Protein in the Database

Small serum protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6imf__assembly_1__model_1

6imf__assembly_1__model_1 | I(q)

6imf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of TOXIN/ANTITOXIN complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cysteine-rich venom protein triflin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small serum protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6imf__assembly_1__model_1

6imf__assembly_1__model_1 | I(q)

6imf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)