6j8v

Structure of MOEN5-SSO7D fusion protein in complex with ligand 2

Method: X-RAY DIFFRACTION D_max: 119.3 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MoeN5,DNA-binding protein 7d

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–260 Chain B； UniProt 1–260	Not recorded	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.23 Å R-free 0.225
2	Insufficient information Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 1–260 Chain D； UniProt 1–260	Not recorded	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.23 Å R-free 0.225

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6J8V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B00 Structure of the prenyltransferase MoeN5 in complex with geranyl pyrophosphate Deposited 2015-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa）	Not recorded	GPP GERANYL DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2 M Na2HPO4, 16% PEG 3350	Resolution 2.95 Å R-free 0.337
5B00 Structure of the prenyltransferase MoeN5 in complex with geranyl pyrophosphate Deposited 2015-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–260（260 aa） Chain C 1–260（260 aa）	Not recorded	GPP GERANYL DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2 M Na2HPO4, 16% PEG 3350	Resolution 2.95 Å R-free 0.337
5B01 Structure of a prenyltransferase in its unbound form Deposited 2015-10-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2M Na2HPO4, 16% PEG 3350	Resolution 3.45 Å R-free 0.261
5B01 Structure of a prenyltransferase in its unbound form Deposited 2015-10-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2M Na2HPO4, 16% PEG 3350	Resolution 3.45 Å R-free 0.261
5B01 Structure of a prenyltransferase in its unbound form Deposited 2015-10-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–260（260 aa） Chain F 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2M Na2HPO4, 16% PEG 3350	Resolution 3.45 Å R-free 0.261
5B01 Structure of a prenyltransferase in its unbound form Deposited 2015-10-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–260（260 aa） Chain H 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2M Na2HPO4, 16% PEG 3350	Resolution 3.45 Å R-free 0.261
5B01 Structure of a prenyltransferase in its unbound form Deposited 2015-10-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain I 1–260（260 aa） Chain J 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；298 K；0.2M Na2HPO4, 16% PEG 3350	Resolution 3.45 Å R-free 0.261
5B02 Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d Deposited 2015-10-27	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350	Resolution 2.21 Å R-free 0.218
5B02 Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d Deposited 2015-10-27	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350	Resolution 2.21 Å R-free 0.218
5B03 Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate Deposited 2015-10-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	GPP GERANYL DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5mM GPP, 0.3M Li3-citrate, 0.4M NaCl, 27% PEG 3350, 5% glycerol	Resolution 2.60 Å R-free 0.239
5B03 Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate Deposited 2015-10-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	GPP GERANYL DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5mM GPP, 0.3M Li3-citrate, 0.4M NaCl, 27% PEG 3350, 5% glycerol	Resolution 2.60 Å R-free 0.239
5B0I Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	BOG octyl beta-D-glucopyranoside × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% Glycerol, 1% beta-octyl glucoside	Resolution 2.26 Å R-free 0.229
5B0I Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% Glycerol, 1% beta-octyl glucoside	Resolution 2.26 Å R-free 0.229
5B0J Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside Deposited 2015-10-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% undecylmaltoside	Resolution 2.50 Å R-free 0.238
5B0J Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% undecylmaltoside	Resolution 2.50 Å R-free 0.238
5B0K Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	DMU DECYL-BETA-D-MALTOPYRANOSIDE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% glycerol, 1% beta-decyl-D-maltoside	Resolution 2.75 Å R-free 0.248
5B0K Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	DMU DECYL-BETA-D-MALTOPYRANOSIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% glycerol, 1% beta-decyl-D-maltoside	Resolution 2.75 Å R-free 0.248
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–260（260 aa） Chain F 1–260（260 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–260（260 aa） Chain H 1–260（260 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–260（260 aa） Chain F 1–260（260 aa）	Not recorded	LMT DODECYL-BETA-D-MALTOSIDE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–260（260 aa） Chain H 1–260（260 aa）	Not recorded	LMT DODECYL-BETA-D-MALTOSIDE × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5GWV Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue Deposited 2016-09-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；Protein: 10mg/mL in 10mM DTT, 1mM MgCl2 Reservoir: 0.2M Li3-citrate, 0.3M NaCl, 25% w/v PEG 3350 Cryoprotectant: 5mM substrate analogue in 0.3M Li3-citrate, 0.4M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.40 Å R-free 0.216
5GWV Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue Deposited 2016-09-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	78S (2R)-3-dimethoxyphosphoryloxy-2-[(2Z,6E)-3,7,11-trimethyldodeca-2,6,10-trienoxy]propanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；Protein: 10mg/mL in 10mM DTT, 1mM MgCl2 Reservoir: 0.2M Li3-citrate, 0.3M NaCl, 25% w/v PEG 3350 Cryoprotectant: 5mM substrate analogue in 0.3M Li3-citrate, 0.4M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.40 Å R-free 0.216
5GWW Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue Deposited 2016-09-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；protein: 10 mg/mL in 10 mM DTT, 1 mM MgCl2 reservoir: 0.2 M Li3 citrate, 0.3 M NaCl, 25% w/v PEG 3350 cryoprotectant: 5 mM permethylated analogue, 0.3 M Li3 citrate, 0.4 M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.30 Å R-free 0.221
5GWW Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue Deposited 2016-09-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	7B5 methyl (2R)-3-dimethoxyphosphoryloxy-2-[(2Z,6E)-3,7,11-trimethyldodeca-2,6,10-trienoxy]propanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；protein: 10 mg/mL in 10 mM DTT, 1 mM MgCl2 reservoir: 0.2 M Li3 citrate, 0.3 M NaCl, 25% w/v PEG 3350 cryoprotectant: 5 mM permethylated analogue, 0.3 M Li3 citrate, 0.4 M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.30 Å R-free 0.221
6J8W Structure of MOEN5-SSO7D fusion protein in complex with lig 1 Deposited 2019-01-21	Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–260（260 aa） Chain B 1–260（260 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.35 Å R-free 0.225
6J8W Structure of MOEN5-SSO7D fusion protein in complex with lig 1 Deposited 2019-01-21	Different ligand/ion Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–260（260 aa） Chain D 1–260（260 aa）	Not recorded	C0X (2S)-3-dimethoxyphosphoryloxy-2-[(2E,6E)-3,7,11-trimethyldodeca-2,6,10-trienoxy]propanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.35 Å R-free 0.225

12 other PDB entries and 31 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A010_9ACTN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 15–274； UniProt 1–260 Author chain B； PDBConstruct 15–274； UniProt 1–260 Author chain C； PDBConstruct 15–274； UniProt 1–260 Author chain D； PDBConstruct 15–274； UniProt 1–260

MoeN5,DNA-binding protein 7d

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

UniProt P39476

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–64 Chain B； UniProt 1–64	Not recorded	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.23 Å R-free 0.225
2	Insufficient information Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 1–64 Chain D； UniProt 1–64	Not recorded	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.23 Å R-free 0.225

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6J8V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BBX NON-SPECIFIC PROTEIN-DNA INTERACTIONS IN THE SSO7D-DNA COMPLEX, NMR, 1 STRUCTURE Deposited 1998-04-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 1–63（63 aa） Chain D 1–63（63 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5；323 K；Ionic strength (raw mmCIF value) 60 mM；Pressure 1 NMR sample composition H2O:D2O 9:1	Resolution not provided
1C8C CRYSTAL STRUCTURES OF THE CHROMOSOMAL PROTEINS SSO7D/SAC7D BOUND TO DNA CONTAINING T-G MISMATCHED BASE PAIRS Deposited 2000-05-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；PROTEIN WAS CRYSTALLIZED FROM 1.3MM SSO7D, 1.3MM DUPLEX DNA, 2.5 MM TRIS (PH 6.5), 2.5% PEG 400, EQUILIBRATED AGAINST 15% PEG 400 at pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 1.45 Å R-free 0.287
1JIC SOLUTION NMR STRUCTURE OF RECOMBINANT SSO7D WITH RNASE ACTIVITY, MINIMIZED AVERAGE STRUCTURE Deposited 1998-07-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–62（62 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4.5；300 K NMR sample composition H2O	Resolution not provided
5B02 Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d Deposited 2015-10-27	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350	Resolution 2.21 Å R-free 0.218
5B02 Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d Deposited 2015-10-27	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350	Resolution 2.21 Å R-free 0.218
5B03 Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate Deposited 2015-10-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	GPP GERANYL DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5mM GPP, 0.3M Li3-citrate, 0.4M NaCl, 27% PEG 3350, 5% glycerol	Resolution 2.60 Å R-free 0.239
5B03 Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate Deposited 2015-10-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	GPP GERANYL DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5mM GPP, 0.3M Li3-citrate, 0.4M NaCl, 27% PEG 3350, 5% glycerol	Resolution 2.60 Å R-free 0.239
5B0I Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	BOG octyl beta-D-glucopyranoside × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% Glycerol, 1% beta-octyl glucoside	Resolution 2.26 Å R-free 0.229
5B0I Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% Glycerol, 1% beta-octyl glucoside	Resolution 2.26 Å R-free 0.229
5B0J Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside Deposited 2015-10-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% undecylmaltoside	Resolution 2.50 Å R-free 0.238
5B0J Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	UMQ UNDECYL-MALTOSIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% undecylmaltoside	Resolution 2.50 Å R-free 0.238
5B0K Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	DMU DECYL-BETA-D-MALTOPYRANOSIDE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% glycerol, 1% beta-decyl-D-maltoside	Resolution 2.75 Å R-free 0.248
5B0K Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside Deposited 2015-10-30	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	DMU DECYL-BETA-D-MALTOPYRANOSIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 5% glycerol, 1% beta-decyl-D-maltoside	Resolution 2.75 Å R-free 0.248
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–64（64 aa） Chain F 1–64（64 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0L Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–64（64 aa） Chain H 1–64（64 aa）	Not recorded	BNG nonyl beta-D-glucopyranoside × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-nonyl-D-glucoside	Resolution 2.80 Å R-free 0.232
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–64（64 aa） Chain F 1–64（64 aa）	Not recorded	LMT DODECYL-BETA-D-MALTOSIDE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5B0M Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside Deposited 2015-11-02	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–64（64 aa） Chain H 1–64（64 aa）	Not recorded	LMT DODECYL-BETA-D-MALTOSIDE × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M Li3-citrate, 0.3M NaCl, 25% PEG 3350, 1% beta-dodecyl-D-maltoside	Resolution 3.05 Å R-free 0.249
5GWV Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue Deposited 2016-09-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；Protein: 10mg/mL in 10mM DTT, 1mM MgCl2 Reservoir: 0.2M Li3-citrate, 0.3M NaCl, 25% w/v PEG 3350 Cryoprotectant: 5mM substrate analogue in 0.3M Li3-citrate, 0.4M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.40 Å R-free 0.216
5GWV Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue Deposited 2016-09-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	78S (2R)-3-dimethoxyphosphoryloxy-2-[(2Z,6E)-3,7,11-trimethyldodeca-2,6,10-trienoxy]propanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；Protein: 10mg/mL in 10mM DTT, 1mM MgCl2 Reservoir: 0.2M Li3-citrate, 0.3M NaCl, 25% w/v PEG 3350 Cryoprotectant: 5mM substrate analogue in 0.3M Li3-citrate, 0.4M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.40 Å R-free 0.216
5GWW Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue Deposited 2016-09-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；protein: 10 mg/mL in 10 mM DTT, 1 mM MgCl2 reservoir: 0.2 M Li3 citrate, 0.3 M NaCl, 25% w/v PEG 3350 cryoprotectant: 5 mM permethylated analogue, 0.3 M Li3 citrate, 0.4 M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.30 Å R-free 0.221
5GWW Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue Deposited 2016-09-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	7B5 methyl (2R)-3-dimethoxyphosphoryloxy-2-[(2Z,6E)-3,7,11-trimethyldodeca-2,6,10-trienoxy]propanoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；protein: 10 mg/mL in 10 mM DTT, 1 mM MgCl2 reservoir: 0.2 M Li3 citrate, 0.3 M NaCl, 25% w/v PEG 3350 cryoprotectant: 5 mM permethylated analogue, 0.3 M Li3 citrate, 0.4 M NaCl, 27% w/v PEG 3350, 5% glycerol	Resolution 2.30 Å R-free 0.221
6J8W Structure of MOEN5-SSO7D fusion protein in complex with lig 1 Deposited 2019-01-21	Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–64（64 aa） Chain B 1–64（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.35 Å R-free 0.225
6J8W Structure of MOEN5-SSO7D fusion protein in complex with lig 1 Deposited 2019-01-21	Different ligand/ion Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	C0X (2S)-3-dimethoxyphosphoryloxy-2-[(2E,6E)-3,7,11-trimethyldodeca-2,6,10-trienoxy]propanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；298 K；0.2M LI3-CITRATE, 0.3M NACL, 25% W/V PEG 3350	Resolution 2.35 Å R-free 0.225
6PUT Structure of HIV cleaved synaptic complex (CSC) intasome bound with calcium Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: dodecameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	CA CALCIUM ION × 4 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å R-free 0.536
6PUT Structure of HIV cleaved synaptic complex (CSC) intasome bound with calcium Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	CA CALCIUM ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å R-free 0.536
6PUT Structure of HIV cleaved synaptic complex (CSC) intasome bound with calcium Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	CA CALCIUM ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å R-free 0.536
6PUW Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and Bictegravir (BIC) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: dodecameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 4 ZN ZINC ION × 4 KLQ Bictegravir × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å R-free 0.534
6PUW Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and Bictegravir (BIC) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 KLQ Bictegravir × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å R-free 0.534
6PUW Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and Bictegravir (BIC) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 KLQ Bictegravir × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å R-free 0.534
6PUY Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ426 (compound 4d) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: dodecameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 4 ZN ZINC ION × 4 OZ1 4-amino-N-[(2,4-difluorophenyl)methyl]-1-hydroxy-6-(6-hydroxyhexyl)-2-oxo-1,2-dihydro-1,8-naphthyridine-3-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å R-free 0.516
6PUY Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ426 (compound 4d) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 OZ1 4-amino-N-[(2,4-difluorophenyl)methyl]-1-hydroxy-6-(6-hydroxyhexyl)-2-oxo-1,2-dihydro-1,8-naphthyridine-3-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å R-free 0.516
6PUY Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ426 (compound 4d) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 OZ1 4-amino-N-[(2,4-difluorophenyl)methyl]-1-hydroxy-6-(6-hydroxyhexyl)-2-oxo-1,2-dihydro-1,8-naphthyridine-3-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å R-free 0.516
6PUZ Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ446 (compound 4f) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: dodecameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 4 ZN ZINC ION × 4 XXJ 4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-[2-(phenylsulfonyl)ethyl]-1,8-naphthyridine-3-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å R-free 0.535
6PUZ Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ446 (compound 4f) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 XXJ 4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-[2-(phenylsulfonyl)ethyl]-1,8-naphthyridine-3-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å R-free 0.535
6PUZ Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ446 (compound 4f) Deposited 2019-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 XXJ 4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-[2-(phenylsulfonyl)ethyl]-1,8-naphthyridine-3-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å R-free 0.535
6V3K Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ419 (compound 4c) Deposited 2019-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: dodecameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 4 ZN ZINC ION × 4 QUW 4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-(5-oxidanylpentyl)-1,8-naphthyridine-3-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å R-free 0.555
6V3K Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ419 (compound 4c) Deposited 2019-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 QUW 4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-(5-oxidanylpentyl)-1,8-naphthyridine-3-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å R-free 0.555
6V3K Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ419 (compound 4c) Deposited 2019-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 4 PDB declaration: hexameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Not recorded	MG MAGNESIUM ION × 2 ZN ZINC ION × 2 QUW 4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-(5-oxidanylpentyl)-1,8-naphthyridine-3-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å R-free 0.555
6VOY Cryo-EM structure of HTLV-1 instasome Deposited 2020-02-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: dodecameric	Chain A 1–64（64 aa） Chain B 1–64（64 aa） Chain C 1–64（64 aa） Chain D 1–64（64 aa）	Mutation：W24A Mutation：W24A Mutation：W24A Mutation：W24A	ZN ZINC ION × 4 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å

19 other PDB entries and 43 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DN72_SULSO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 280–343； UniProt 1–64 Author chain B； PDBConstruct 280–343； UniProt 1–64 Author chain C； PDBConstruct 280–343； UniProt 1–64 Author chain D； PDBConstruct 280–343； UniProt 1–64

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6j8v
Deposition date deposition_date	2019-01-21
Structure title title	Structure of MOEN5-SSO7D fusion protein in complex with ligand 2
Keywords keywords	MOENOMYCIN, ANTIBIOTICS, BIOSYNTHESIS, PRENYL TRANSFERASE, ALPHA, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	35.09 Å
Radius of gyration Rg (electron density) rg_electron	34.86 Å
Forward intensity I(0) i0	255873000.00
Molecular weight molecular_weight	124580.0 kDa
Excluded volume excluded_volume	154370 Å³
Envelope volume envelope_volume	202230 Å³
Hydration-shell volume shell_volume	48330 Å³
Envelope diameter envelope_diameter	123.4 Å
Shell Rg shell_rg	41.19 Å
Envelope Rg envelope_rg	34.94 Å
Shape Rg shape_rg	34.88 Å
Total Rg total_rg	35.21 Å
Total atoms total_atoms	8741
Residues n_residues	1142
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	119.3 Å
Rg (real space) rg_real	35.06 Å
Rg uncertainty (real space) rg_real_error	1.00 Å
I(0) (real space) i0_real	2.5590e+08
I(0) uncertainty (real space) i0_real_error	3.8930e+06
Rg (reciprocal space) rg_reciprocal	35.08 Å
I(0) (reciprocal space) i0_reciprocal	255900000.0000
Solution quality estimate total_estimate	0.6214
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	39.8 Å
Skewness Skewness skewness	0.324
Kurtosis Kurtosis kurtosis	-0.344
Angular range angular_range	— – 0.2250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	44320000.0000
Real-space data points n_real_points	46
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.840; Stabil: 1.000; Sysdev: 0.186; Positv: 1.000; Valcen: 0.996; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	MoeN5,DNA-binding protein 7d
Molecular weight formula_weight	37581.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	9300

MAHHHHHHVDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLGEAGAGAMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

来源 Source

来源生物 organism	Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
NCBI Class编号 ncbi_taxonomy_id	273057
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	FARNESYL
Molecular weight formula_weight	206.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	559

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6j8vA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	600 — Farnesyl Diphosphate Synthase
Homologous superfamily homologous superfamily	10 — Farnesyl Diphosphate Synthase

Domain ID domain_id	6j8vB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	600 — Farnesyl Diphosphate Synthase
Homologous superfamily homologous superfamily	10 — Farnesyl Diphosphate Synthase

Domain ID domain_id	6j8vC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	600 — Farnesyl Diphosphate Synthase
Homologous superfamily homologous superfamily	10 — Farnesyl Diphosphate Synthase

Domain ID domain_id	6j8vD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	600 — Farnesyl Diphosphate Synthase
Homologous superfamily homologous superfamily	10 — Farnesyl Diphosphate Synthase

▶

8. Citations (1)

▶

Unit-cell length a length_a	137.856 Å
Unit-cell length b length_b	217.336 Å
Unit-cell length c length_c	104.159 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	C 2 2 2
Space-group number int_tables_number	21
Crystal system crystal_system	—

Resolution resolution	2.230 Å
Low-resolution limit resolution_low	25.000 Å
R factor r_factor	0.1740
R_work r_work	0.1715
R_free r_free	0.2250

fit	/app/data/saxs_computation/j8/6j8v/6j8v.fit
pddf	/app/data/pr_computation/j8/6j8v/6j8v.pr.out
profile	/app/data/saxs_computation/j8/6j8v/6j8v.dat

Structure of MOEN5-SSO7D fusion protein in complex with ligand 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

MoeN5,DNA-binding protein 7d

State in the Current Structure

Other States of the Same Protein in the Database

MoeN5,DNA-binding protein 7d

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)