SAXSdb — 6jzw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Zinc-dependent sulfurtransferase SufU

Bacillus subtilis (strain 168)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	ZINC ION × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	ZINC ION × 1 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	ZINC ION × 1 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUFU_BACSU
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–147； UniProt 1–147 Author chain B； PDBConstruct 1–147； UniProt 1–147 Author chain C； PDBConstruct 1–147； UniProt 1–147 Author chain D； PDBConstruct 1–147； UniProt 1–147

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6jzw
Deposition date deposition_date	2019-05-04
Structure title title	Crystal structure of SufU from Bacillus subtilis with Cys persulfurated
Keywords keywords	Iron-sulfur cluster biosynthesis, Sulfur mobilization, BIOSYNTHETIC PROTEIN; BIOSYNTHETIC PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6jzw__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6jzw__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6jzw__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.78 Å
Rg (electron density)	14.68 Å
Total Rg	15.70 Å
Atom count	1091
Residues	141
Excluded volume	19470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6jzw__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6jzw__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6jzw__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6jzw__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Zinc-dependent sulfurtransferase SufU
Molecular weight formula_weight	17256.6 kDa
EC 编号 ec_number	2.-.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4268

MSFNANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAKEEGGNLEHHHHHH

Source Source

Source organism organism	Bacillus subtilis (strain 168)
NCBI taxonomy ID ncbi_taxonomy_id	224308
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Zinc-dependent sulfurtransferase SufU
Molecular weight formula_weight	17288.7 kDa
EC 编号 ec_number	2.-.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MSFNANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAKEEGGNLEHHHHHH

Source Source

Source organism organism	Bacillus subtilis (strain 168)
NCBI taxonomy ID ncbi_taxonomy_id	224308
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	26

▼

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6jzwa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.224 — SufE/NifU
Superfamily Superfamily superfamily	d.224.1 — SufE/NifU
Family Family family	d.224.1.2 — NifU/IscU domain

Domain ID domain_id	d6jzwb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.224 — SufE/NifU
Superfamily Superfamily superfamily	d.224.1 — SufE/NifU
Family Family family	d.224.1.2 — NifU/IscU domain

Domain ID domain_id	d6jzwc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.224 — SufE/NifU
Superfamily Superfamily superfamily	d.224.1 — SufE/NifU
Family Family family	d.224.1.2 — NifU/IscU domain

Domain ID domain_id	d6jzwd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.224 — SufE/NifU
Superfamily Superfamily superfamily	d.224.1 — SufE/NifU
Family Family family	d.224.1.2 — NifU/IscU domain

CATH v4.4 (3 domains)

Domain ID domain_id	6jzwA00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1010 — Sufe protein. Chain: A
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6jzwB00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1010 — Sufe protein. Chain: A
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6jzwD00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1010 — Sufe protein. Chain: A
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	146.690 Å
Unit-cell length b length_b	35.520 Å
Unit-cell length c length_c	105.220 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	96.41 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.640 Å
Low-resolution limit resolution_low	44.924 Å
R factor r_factor	0.2430
R_work r_work	0.2422
R_free r_free	0.2566

Crystal structure of SufU from Bacillus subtilis with Cys persulfurated

1. Protein Identity and Related Structures Protein Identity & Related Structures

Zinc-dependent sulfurtransferase SufU

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6jzw__assembly_3__model_1

6jzw__assembly_3__model_1 | I(q)

6jzw__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

CATH v4.4 (3 domains)

7. Citations (1)

Crystal structure of SufU from Bacillus subtilis with Cys persulfurated

1. Protein Identity and Related Structures Protein Identity & Related Structures

Zinc-dependent sulfurtransferase SufU

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6jzw__assembly_3__model_1

6jzw__assembly_3__model_1 | I(q)

6jzw__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

CATH v4.4 (3 domains)

7. Citations (1)