SAXSdb — 6kyw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Receptor protein kinase SRK8

Brassica campestris

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	S locus protein 11 × 2 （Q9SE17） 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q39276_BRACM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–433； UniProt 1–433 Author chain B； PDBConstruct 1–433； UniProt 1–433

S locus protein 11

OrganismNot specified

UniProt Q9SE17

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Receptor protein kinase SRK8 × 2 （Q39276） 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9SE17_BRACM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–46； UniProt 29–74 Author chain D； PDBConstruct 1–46； UniProt 29–74

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6kyw
Deposition date deposition_date	2019-09-20
Structure title title	S8-mSRK-S8-SP11 complex
Keywords keywords	Ligand-receptor complex, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6kyw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6kyw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6kyw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.56 Å
Rg (electron density)	30.04 Å
Total Rg	30.65 Å
Atom count	6822
Residues	867
Excluded volume	119470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6kyw__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Receptor protein kinase SRK8
Molecular weight formula_weight	50509.5 kDa
Mutation mutation	P79S, Y80E, I81R, F108V, L110R, L180R, F190S, L214Q, L239S, K248E, V286G, V287A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	7006

MQGVRYIYHHFYTSLLVFVVMILFRSALSIYINTLSSTESLTISNNRTLVSPGDVFELGFFTPGSSSRWYLGIWYKKLSERTYVWVANRDNPLSNSTGTLKISGNNLVLRGDSNKSIWSTNLTRGNERSPVVAELLANGNFVMRDSNNNDASGFLWQSFDYPTDTLLPEMKLGYDLKTGRNRFLTSSRNSDDPSSGDYSYKLEPRRLPEFYLLQGDVREHRSGPWNGIQFSGIPEDQKSSYMVYNFTENSEEVAYTFRMTNNSFYSRLTINSEGYLERLTWAPSSGAWNVFWSSPNHQCDMYRMCGPYSYCDVNTSPSCNCIQGFNPGNVQQWALRNQISGCKRRTRLSCNGDGFTRMKNIKLPDTRMAIVDRSIGLKECEKRCLSDCNCTAFANADIRNRVTGCVIWTGELEDMRNYAEGGQDLYVRLAAADSRLEVLFQGP

Source Source

Source organism organism	Brassica campestris
Common name common_name	Field mustard
NCBI taxonomy ID ncbi_taxonomy_id	3711
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	S locus protein 11
Molecular weight formula_weight	5249.1 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

RCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	184

▶

Unit-cell length a length_a	143.562 Å
Unit-cell length b length_b	143.562 Å
Unit-cell length c length_c	194.401 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	tetragonal

Resolution resolution	2.601 Å
Low-resolution limit resolution_low	43.836 Å
R factor r_factor	0.2210
R_work r_work	0.2199
R_free r_free	0.2509

S8-mSRK-S8-SP11 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Receptor protein kinase SRK8

State in the Current Structure

Other States of the Same Protein in the Database

S locus protein 11

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6kyw__assembly_1__model_1

6kyw__assembly_1__model_1 | I(q)

6kyw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

S8-mSRK-S8-SP11 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Receptor protein kinase SRK8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

S locus protein 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6kyw__assembly_1__model_1

6kyw__assembly_1__model_1 | I(q)

6kyw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)