SAXSdb — 6lgl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2760	Small capsomere-interacting protein × 900 （Q6QCN2） Triplex capsid protein 1 × 300 （Q6QCN5） Triplex capsid protein 2 × 600 （Q6QCL4）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 46	Small capsomere-interacting protein × 15 （Q6QCN2） Triplex capsid protein 1 × 5 （Q6QCN5） Triplex capsid protein 2 × 10 （Q6QCL4）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 230	Small capsomere-interacting protein × 75 （Q6QCN2） Triplex capsid protein 1 × 25 （Q6QCN5） Triplex capsid protein 2 × 50 （Q6QCL4）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 276	Small capsomere-interacting protein × 90 （Q6QCN2） Triplex capsid protein 1 × 30 （Q6QCN5） Triplex capsid protein 2 × 60 （Q6QCL4）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 46	Small capsomere-interacting protein × 15 （Q6QCN2） Triplex capsid protein 1 × 5 （Q6QCN5） Triplex capsid protein 2 × 10 （Q6QCL4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6QCL5_HHV3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1396； UniProt 1–1396 Author chain B； PDBConstruct 1–1396； UniProt 1–1396 Author chain C； PDBConstruct 1–1396； UniProt 1–1396 Author chain E； PDBConstruct 1–1396； UniProt 1–1396 Author chain F； PDBConstruct 1–1396； UniProt 1–1396 Author chain G； PDBConstruct 1–1396； UniProt 1–1396 Author chain M； PDBConstruct 1–1396； UniProt 1–1396 Author chain N； PDBConstruct 1–1396； UniProt 1–1396 Author chain O； PDBConstruct 1–1396； UniProt 1–1396 Author chain P； PDBConstruct 1–1396； UniProt 1–1396 Author chain Q； PDBConstruct 1–1396； UniProt 1–1396 Author chain R； PDBConstruct 1–1396； UniProt 1–1396 Author chain S； PDBConstruct 1–1396； UniProt 1–1396 Author chain T； PDBConstruct 1–1396； UniProt 1–1396 Author chain U； PDBConstruct 1–1396； UniProt 1–1396 Author chain z； PDBConstruct 1–1396； UniProt 1–1396

Small capsomere-interacting protein

OrganismNot specified

UniProt Q6QCN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2760	Major capsid protein × 960 （Q6QCL5） Triplex capsid protein 1 × 300 （Q6QCN5） Triplex capsid protein 2 × 600 （Q6QCL4）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 46	Major capsid protein × 16 （Q6QCL5） Triplex capsid protein 1 × 5 （Q6QCN5） Triplex capsid protein 2 × 10 （Q6QCL4）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 230	Major capsid protein × 80 （Q6QCL5） Triplex capsid protein 1 × 25 （Q6QCN5） Triplex capsid protein 2 × 50 （Q6QCL4）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 276	Major capsid protein × 96 （Q6QCL5） Triplex capsid protein 1 × 30 （Q6QCN5） Triplex capsid protein 2 × 60 （Q6QCL4）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 46	Major capsid protein × 16 （Q6QCL5） Triplex capsid protein 1 × 5 （Q6QCN5） Triplex capsid protein 2 × 10 （Q6QCL4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6QCN2_HHV3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–235； UniProt 1–235 Author chain H； PDBConstruct 1–235； UniProt 1–235 Author chain I； PDBConstruct 1–235； UniProt 1–235 Author chain J； PDBConstruct 1–235； UniProt 1–235 Author chain K； PDBConstruct 1–235； UniProt 1–235 Author chain L； PDBConstruct 1–235； UniProt 1–235 Author chain V； PDBConstruct 1–235； UniProt 1–235 Author chain W； PDBConstruct 1–235； UniProt 1–235 Author chain X； PDBConstruct 1–235； UniProt 1–235 Author chain Y； PDBConstruct 1–235； UniProt 1–235 Author chain Z； PDBConstruct 1–235； UniProt 1–235 Author chain a； PDBConstruct 1–235； UniProt 1–235 Author chain b； PDBConstruct 1–235； UniProt 1–235 Author chain c； PDBConstruct 1–235； UniProt 1–235 Author chain d； PDBConstruct 1–235； UniProt 1–235

Triplex capsid protein 1

OrganismNot specified

UniProt Q6QCN5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2760	Major capsid protein × 960 （Q6QCL5） Small capsomere-interacting protein × 900 （Q6QCN2） Triplex capsid protein 2 × 600 （Q6QCL4）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 46	Major capsid protein × 16 （Q6QCL5） Small capsomere-interacting protein × 15 （Q6QCN2） Triplex capsid protein 2 × 10 （Q6QCL4）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 230	Major capsid protein × 80 （Q6QCL5） Small capsomere-interacting protein × 75 （Q6QCN2） Triplex capsid protein 2 × 50 （Q6QCL4）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 276	Major capsid protein × 96 （Q6QCL5） Small capsomere-interacting protein × 90 （Q6QCN2） Triplex capsid protein 2 × 60 （Q6QCL4）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 46	Major capsid protein × 16 （Q6QCL5） Small capsomere-interacting protein × 15 （Q6QCN2） Triplex capsid protein 2 × 10 （Q6QCL4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6QCN5_HHV3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain e； PDBConstruct 1–483； UniProt 1–483 Author chain f； PDBConstruct 1–483； UniProt 1–483 Author chain g； PDBConstruct 1–483； UniProt 1–483 Author chain h； PDBConstruct 1–483； UniProt 1–483 Author chain i； PDBConstruct 1–483； UniProt 1–483

Triplex capsid protein 2

OrganismNot specified

UniProt Q6QCL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2760	Major capsid protein × 960 （Q6QCL5） Small capsomere-interacting protein × 900 （Q6QCN2） Triplex capsid protein 1 × 300 （Q6QCN5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 46	Major capsid protein × 16 （Q6QCL5） Small capsomere-interacting protein × 15 （Q6QCN2） Triplex capsid protein 1 × 5 （Q6QCN5）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 230	Major capsid protein × 80 （Q6QCL5） Small capsomere-interacting protein × 75 （Q6QCN2） Triplex capsid protein 1 × 25 （Q6QCN5）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 276	Major capsid protein × 96 （Q6QCL5） Small capsomere-interacting protein × 90 （Q6QCN2） Triplex capsid protein 1 × 30 （Q6QCN5）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 46	Major capsid protein × 16 （Q6QCL5） Small capsomere-interacting protein × 15 （Q6QCN2） Triplex capsid protein 1 × 5 （Q6QCN5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6QCL4_HHV3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain j； PDBConstruct 1–316； UniProt 1–316 Author chain k； PDBConstruct 1–316； UniProt 1–316 Author chain l； PDBConstruct 1–316； UniProt 1–316 Author chain m； PDBConstruct 1–316； UniProt 1–316 Author chain n； PDBConstruct 1–316； UniProt 1–316 Author chain o； PDBConstruct 1–316； UniProt 1–316 Author chain p； PDBConstruct 1–316； UniProt 1–316 Author chain q； PDBConstruct 1–316； UniProt 1–316 Author chain r； PDBConstruct 1–316； UniProt 1–316 Author chain s； PDBConstruct 1–316； UniProt 1–316

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6lgl
Deposition date deposition_date	2019-12-05
Structure title title	The atomic structure of varicella-zoster virus A-capsid
Keywords keywords	Herpesvirus, varicella-zoster virus, capsid, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6lgl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6lgl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6lgl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	551.40 Å
Total Rg	551.10 Å
Atom count	12500760
Residues	1603140
Excluded volume	222100000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6lgl__assembly_1__model_1`	2760-meric （2760）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6lgl__assembly_2__model_1`	46-meric （46）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`6lgl__assembly_3__model_1`	230-meric （230）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`6lgl__assembly_4__model_1`	276-meric （276）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`6lgl__assembly_5__model_1`	46-meric （46）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Major capsid protein
Molecular weight formula_weight	155145.4 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,M,N,O,P,Q,R,S,T,U,B,C,E,F,G,z
Atom count atom_count	208346

MTTVSCPANVITTTESDRIAGLFNIPAGIIPTGNVLSTIEVCAHRCIFDFFKQIRSDDNSLYSAQFDILLGTYCNTLNFVRFLELGLSVACICTKFPELAYVRDGVIQFEVQQPMIARDGPHPVDQPVHNYMVKRIHKRSLSAAFAIASEALSLLSNTYVDGTEIDSSLRIRAIQQMARNLRTVLDSFERGTADQLLGVLLEKAPPLSLLSPINKFQPEGHLNRVARAALLSDLKRRVCADMFFMTRHAREPRLISAYLSDMVSCTQPSVMVSRITHTNTRGRQVDGVLVTTATLKRQLLQGILQIDDTAADVPVTYGEMVLQGTNLVTALVMGKAVRGMDDVARHLLDITDPNTLNIPSIPPQSNSDSTTAGLPVNARVPADLVIVGDKLVFLEALERRVYQATRVAYPLIGNIDITFIMPMGVFQANSMDRYTRHAGDFSTVSEQDPRQFPPQGIFFYNKDGILTQLTLRDAMGTICHSSLLDVEATLVALRQQHLDRQCYFGVYVAEGTEDTLDVQMGRFMETWADMMPHHPHWVNEHLTILQFIAPSNPRLRFELNPAFDFFVAPGDVDLPGPQRPPEAMPTVNATLRIINGNIPVPLCPISFRDCRGTQLGLGRHTMTPATIKAVKDTFEDRAYPTIFYMLEAVIHGNERNFCALLRLLTQCIRGYWEQSHRVAFVNNFHMLMYITTYLGNGELPEVCINIYRDLLQHVRALRQTITDFTIQGEGHNGETSEALNNILTDDTFIAPILWDCDALIYRDEAARDRLPAIRVSGRNGYQALHFVDMAGHNFQRRDNVLIHGRPVRGDTGQGIPITPHHDREWGILSKIYYYIVIPAFSRGSCCTMGVRYDRLYPALQAVIVPEIPADEEAPTTPEDPRHPLHAHQLVPNSLNVYFHNAHLTVDGDALLTLQELMGDMAERTTAILVSSAPDAGAATATTRNMRIYDGALYHGLIMMAYQAYDETIATGTFFYPVPVNPLFACPEHLASLRGMTNARRVLAKMVPPIPPFLGANHHATIRQPVAYHVTHSKSDFNTLTYSLLGGYFKFTPISLTHQLRTGFHPGIAFTVVRQDRFATEQLLYAERASESYFVGQIQVHHHDAIGGVNFTLTQPRAHVDLGVGYTAVCATAALRCPLTDMGNTAQNLFFSRGGVPMLHDNVTESLRRITASGGRLNPTEPLPIFGGLRPATSAGIARGQASVCEFVAMPVSTDLQYFRTACNPRGRASGMLYMGDRDADIEAIMFDHTQSDVAYTDRATLNPWASQKHSYGDRLYNGTYNLTGASPIYSPCFKFFTPAEVNTNCNTLDRLLMEAKAVASQSSTDTEYQFKRPPGSTEMTQDPCGLFQEAYPPLCSSDAAMLRTAHAGETGADEVHLAQYLIRDASPLRGCLPLPR

Entity 2 Entity 2 polymer

Description description	Small capsomere-interacting protein
Molecular weight formula_weight	24440.1 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,V,W,X,Y,Z,a,b,c,d,H,I,J,K,L

MTQPASSRVVFDPSNPTTFSVEAIAAYTPVALIRLLNASGPLQPGHRVDIADARSIYTVGAAASAARARANHNANTIRRTAMFAETDPMTWLRPTVGLKRTFNPRIIRPQPPNPSMSLGISGPTILPQKTQSADQSALQQPAALAFSGSSPQHPPPQTTSASVGQQQHVVSGSSGQQPQQGAQSSTVQPTTGSPPAAQGVPQSTPPPTQNTPQGGKGQTLSHTGQSGNASRSRRV

Entity 3 Entity 3 polymer

Description description	Triplex capsid protein 1
Molecular weight formula_weight	54028.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g,h,i

MGSQPTNSHFTLNEQTLCGTNISLLGNNRFIQIGNGLHMTYAPGFFGNWSRDLTIGPRFGGLNKQPIHVPPKRTETASIQVTPRSIVINRMNNIQINPTSIGNPQVTIRLPLNNFKSTTQLIQQVSLTDFFRPDIEHAGSIVLILRHPSDMIGEANTLTQAGRDPDVLLEGLRNLFNACTAPWTVGEGGGLRAYVTSLSFIAACRAEEYTDKQAADANRTAIVSAYGCSRMETRLIRFSECLRAMVQCHVFPHRFISFFGSLLEYTIQDNLCNITAVAKGPQEAARTDKTSTRRVTANIPACVFWDVDKDLHLSADGLKHVFLVFVYTQRRQREGVRLHLALSQLNEQCFGRGIGFLLGRIRAENAAWGTEGVANTHQPYNTRALPLVQLSNDPTSPRCSIGEITGVNWNLARQRLYQWTGDFRGLPTQLSCMYAAYTLIGTIPSESVRYTRRMERFGGYNVPTIWLEGVVWGGTNTWNECYY

Entity 4 Entity 4 polymer

Description description	Triplex capsid protein 2
Molecular weight formula_weight	34421.9 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,o,k,p,l,q,m,r,n,s

MAMPFEIEVLLPGELSPAETSALQKCEGKIITFSTLRHRASLVDIALSSYYINGAPPDTLSLLEAYRMRFAAVITRVIPGKLLAHAIGVGTPTPGLFIQNTSPVDLCNGDYICLLPPVFGSADSIRLDSVGLEIVFPLTIPQTLMREIIAKVVARAVERTAAGAQILPHEVLRGADVICYNGRRYELETNLQHRDGSDAAIRTLVLNLMFSINEGCLLLLALIPTLLVQGAHDGYVNLLIQTANCVRETGQLINIPPMPRIQDGHRRFPIYETISSWISTSSRLGDTLGTRAILRVCVFDGPSTVHPGDRTAVIQV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	22983

The atomic structure of varicella-zoster virus A-capsid

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Small capsomere-interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

Triplex capsid protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Triplex capsid protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6lgl__assembly_1__model_1

6lgl__assembly_1__model_1 | I(q)

6lgl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)

The atomic structure of varicella-zoster virus A-capsid

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small capsomere-interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Triplex capsid protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Triplex capsid protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6lgl__assembly_1__model_1

6lgl__assembly_1__model_1 | I(q)

6lgl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)