SAXSdb — 6lnp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Green fluorescent protein and Sensor histidine kinase CitA

Aequorea victoria

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	CITRIC ACID × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	CITRIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CITA_KLEPN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 182–276； UniProt 47–141 Author chain D； PDBConstruct 182–276； UniProt 47–141

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6lnp
Deposition date deposition_date	2019-12-31
Structure title title	Crystal structure of citrate Biosensor
Keywords keywords	Biosensor, Genetically Encoded, Citrate, FLUORESCENT PROTEIN; FLUORESCENT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6lnp__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6lnp__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6lnp__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.85 Å
Rg (electron density)	23.00 Å
Total Rg	23.84 Å
Atom count	2769
Residues	362
Excluded volume	48923 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6lnp__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6lnp__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Fusion protein of Green fluorescent protein and Sensor histidine kinase CitA
Molecular weight formula_weight	44871.6 kDa
EC 编号 ec_number	2.7.13.3
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D
Atom count atom_count	5578

MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRMVSKGEELFTGVVPILAELDGDVNGHKFSVSGEGEGDATYGKLTMKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMRQHDFFKSAMPEGYIQERTIFFKGDGNYKTRAEVKFEGDTLVNRIELKGADFREDGNILGHKLVYNMVTEERLHHQVGQRALIQAMQISTMPELVEAVQKRDLARIKALIDPMRSFPDATYITVGDASGQRLYHVNPDEIGKSMVGGDSDEALINAKGYVSVRKGSLGSSLRGKSPILDATGRVVGIVSVGYTIEQLESNLVYIKADKQKNGIKANFHVRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSELSKDPNEKRDHMVLQEHVTAAGITLGMAELYK

Source Source

Source organism organism	Aequorea victoria
NCBI taxonomy ID ncbi_taxonomy_id	6100
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CITRIC ACID
Molecular weight formula_weight	192.1 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6lnpB01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	155 — Green Fluorescent Protein
Homologous superfamily homologous superfamily	10 — Green fluorescent protein

Domain ID domain_id	6lnpB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	20 — PAS domain

Domain ID domain_id	6lnpD01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	155 — Green Fluorescent Protein
Homologous superfamily homologous superfamily	10 — Green fluorescent protein

Domain ID domain_id	6lnpD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	450 — Beta-Lactamase
Homologous superfamily homologous superfamily	20 — PAS domain

▶

Unit-cell length a length_a	92.410 Å
Unit-cell length b length_b	92.410 Å
Unit-cell length c length_c	123.020 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41
Space-group number int_tables_number	76
Crystal system crystal_system	—

Resolution resolution	2.993 Å
Low-resolution limit resolution_low	46.205 Å
R factor r_factor	0.2287
R_work r_work	0.2227
R_free r_free	0.2823

Crystal structure of citrate Biosensor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Green fluorescent protein and Sensor histidine kinase CitA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6lnp__assembly_2__model_1

6lnp__assembly_2__model_1 | I(q)

6lnp__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (2)

Crystal structure of citrate Biosensor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Green fluorescent protein and Sensor histidine kinase CitA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6lnp__assembly_2__model_1

6lnp__assembly_2__model_1 | I(q)

6lnp__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (2)