SAXSdb — 6m63

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein

Mesorhizobium japonicum MAFF 303099

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A059PIR9_AEQVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 77–166； UniProt 149–238 Author chain A； PDBConstruct 176–315； UniProt 3–144 Author chain B； PDBConstruct 77–166； UniProt 149–238 Author chain B； PDBConstruct 176–315； UniProt 3–144

Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein

Mesorhizobium japonicum MAFF 303099

UniProt Q98GN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CNGK1_RHILO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–73； UniProt 213–284 Author chain A； PDBConstruct 318–387； UniProt 286–355 Author chain B； PDBConstruct 2–73； UniProt 213–284 Author chain B； PDBConstruct 318–387； UniProt 286–355

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6m63
Deposition date deposition_date	2020-03-12
Structure title title	Crystal structure of a cAMP sensor G-Flamp1.
Keywords keywords	GFP, CNBD, complex, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6m63__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6m63__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6m63__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.78 Å
Rg (electron density)	22.17 Å
Total Rg	22.98 Å
Atom count	2744
Residues	358
Excluded volume	48967 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6m63__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6m63__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein
Molecular weight formula_weight	42620.6 kDa
Mutation mutation	D173G, S175G, D180Y, Y203V, A206K, H231L, S30R, V93I, S99V, S308V
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5855

MGFYQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATNWGNVYITADKQKNGIKANFKIRHNVEGGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLXVQCFARYPDHMKQHDFFKSAMPEGYIQERTIVFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNRVNPVELGPGAFFGEMALISGEPRVATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA

Source Source

Source organism organism	Mesorhizobium japonicum MAFF 303099
NCBI taxonomy ID ncbi_taxonomy_id	266835
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE
Molecular weight formula_weight	329.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	365

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	6m63A01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	155 — Green Fluorescent Protein
Homologous superfamily homologous superfamily	10 — Green fluorescent protein

Domain ID domain_id	6m63B01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	155 — Green Fluorescent Protein
Homologous superfamily homologous superfamily	10 — Green fluorescent protein

▶

Unit-cell length a length_a	87.836 Å
Unit-cell length b length_b	94.688 Å
Unit-cell length c length_c	109.985 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	2.250 Å
Low-resolution limit resolution_low	47.550 Å
R factor r_factor	0.1804
R_work r_work	0.1784
R_free r_free	0.2233

Crystal structure of a cAMP sensor G-Flamp1.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6m63__assembly_2__model_1

6m63__assembly_2__model_1 | I(q)

6m63__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of a cAMP sensor G-Flamp1.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6m63__assembly_2__model_1

6m63__assembly_2__model_1 | I(q)

6m63__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)