6nbq

T.elongatus NDH (data-set 1)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NAD(P)H-quinone oxidoreductase subunit H

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHH_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain H； PDBConstruct 1–394； UniProt 1–394

NAD(P)H-quinone oxidoreductase subunit J

OrganismNot specified

UniProt Q8DJ01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHJ_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–168； UniProt 1–168

NAD(P)H-quinone oxidoreductase subunit K

OrganismNot specified

UniProt Q8DKZ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHK_THEEB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 1–237； UniProt 1–237

NAD(P)H-quinone oxidoreductase subunit I

OrganismNot specified

UniProt Q8DL31

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHI_THEEB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–196； UniProt 1–196

NAD(P)H-quinone oxidoreductase subunit N

OrganismNot specified

UniProt Q8DJU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHN_THEEB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain N； PDBConstruct 1–150； UniProt 1–150

NAD(P)H-quinone oxidoreductase subunit L

OrganismNot specified

UniProt Q8DKZ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHL_THEEB
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–76； UniProt 1–76

NAD(P)H-quinone oxidoreductase subunit M

OrganismNot specified

UniProt Q8DLN5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHM_THEEB
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–111； UniProt 1–111

NAD(P)H-quinone oxidoreductase subunit O

OrganismNot specified

UniProt Q8DMU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHO_THEEB
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–70； UniProt 1–70

Tlr0636 protein

OrganismNot specified

UniProt Q8DL61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DL61_THEEB
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain S； PDBConstruct 1–110； UniProt 1–110

NAD(P)H-quinone oxidoreductase subunit 3

OrganismNot specified

UniProt Q8DJ02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3C_THEEB
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain C； PDBConstruct 1–132； UniProt 1–132

NAD(P)H-quinone oxidoreductase subunit 4L

OrganismNot specified

UniProt Q8DL29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DL29_THEEB
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain E； PDBConstruct 1–101； UniProt 1–101

Proton-translocating NADH-quinone dehydrogenase subunit P NdhP

OrganismNot specified

UniProt V5V507

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V5V507_9CYAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain P； PDBConstruct 1–44； UniProt 1–44

NADH dehydrogenase subunit 5

OrganismNot specified

UniProt Q8DKX9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DKX9_THEEB
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain F； PDBConstruct 1–656； UniProt 1–656

NAD(P)H-quinone oxidoreductase chain 4 1

OrganismNot specified

UniProt Q8DKY0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4C1_THEEB
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain D； PDBConstruct 1–529； UniProt 1–529

NAD(P)H-quinone oxidoreductase subunit 2

OrganismNot specified

UniProt Q8DMR6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NADH-quinone oxidoreductase subunit J × 1 （Q8DL30） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2C_THEEB
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain B； PDBConstruct 1–515； UniProt 1–515

NADH-quinone oxidoreductase subunit J

OrganismNot specified

UniProt Q8DL30

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit H × 1 （Q8DJD9） NAD(P)H-quinone oxidoreductase subunit J × 1 （Q8DJ01） NAD(P)H-quinone oxidoreductase subunit K × 1 （Q8DKZ4） NAD(P)H-quinone oxidoreductase subunit I × 1 （Q8DL31） NAD(P)H-quinone oxidoreductase subunit N × 1 （Q8DJU2） NAD(P)H-quinone oxidoreductase subunit L × 1 （Q8DKZ3） NAD(P)H-quinone oxidoreductase subunit M × 1 （Q8DLN5） NAD(P)H-quinone oxidoreductase subunit O × 1 （Q8DMU4） Tlr0636 protein × 1 （Q8DL61） NdhA × 1 NAD(P)H-quinone oxidoreductase subunit 3 × 1 （Q8DJ02） NAD(P)H-quinone oxidoreductase subunit 4L × 1 （Q8DL29） Proton-translocating NADH-quinone dehydrogenase subunit P NdhP × 1 （V5V507） NADH dehydrogenase subunit 5 × 1 （Q8DKX9） NAD(P)H-quinone oxidoreductase chain 4 1 × 1 （Q8DKY0） NAD(P)H-quinone oxidoreductase subunit 2 × 1 （Q8DMR6） IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DL30_THEEB
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain G； PDBConstruct 1–200； UniProt 1–200

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6nbq
Deposition date deposition_date	2018-12-09
Structure title title	T.elongatus NDH (data-set 1)
Keywords keywords	photosynthesis, bioenergetics, membrane protein complex, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6nbq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6nbq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6nbq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	63.32 Å
Rg (electron density)	63.97 Å
Total Rg	63.80 Å
Atom count	28296
Residues	3755
Excluded volume	514920 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6nbq__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit H
Molecular weight formula_weight	45271.2 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H
Atom count atom_count	28296

MPKIETRTEPMVINMGPHHPSMHGVLRLMVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNIMFIPYVSRWDYAAGMFNEAVTVNAPEKLAGIPVPKRASYIRVIMLELNRIANHLLWLGPFLADVGAQTPFFYIFREREYIYDLFEAATGMRFINNNYFRIGGVAADLTYGWVTKCRDFCDYFLPKVDEYERLITNNPIFVRRLQGVGKISREEAINWGLSGPMLRASGVKWDLRKVDHYECYDDFDWDVPVATEGDCLARYIVRIQEMRESVKIIRQALDGLPGGPYENLEAKRMLEGAKSEWNGFDYQYIGKKLSPTFKIPKGEHYVRVESGKGELGIYLIGDDNVFPWRWKIRPPDFNNLQVLPQLLKGMKVADIVAILGSIDVIMGSVDR

Entity 2 Entity 2 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit J
Molecular weight formula_weight	19363.8 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSDTPEAPIVEAGPVGRLLQSQNLSVESLGRDASGVEMIKVDRDRLLAVCQTLYADGFNYLRCQAAYDSGPGQDLVSTYHLIKLSDNADRPPEVRIKVFVPRDDPRVPSVYWIWKTADWQERESYDMFGIVYEGHPNLKRILMPEDWVGWPLRKDYITPDFYELQEAY

Entity 3 Entity 3 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit K
Molecular weight formula_weight	25767.0 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTNTTSPAILNPIARPEVPQELAENIILTSLNDVYDWARLSSLWPLMYGTACCFIEFAAMIGSRFDFDRFGLVPRNSPRQADLIITSGTITMKMAPALVRLYEQMPSPKYVIAMGACTITGGMFSSDSYSAVRGVDKLIPVDVYLPGCPPRPEAIMDAIVKLRKKIANEHINERGNLAQTHRLFTAKHKMKPVPPILTGQYLNAPSRQAPPPALAAAMGIAVPALGEAVSETTSVAE

Entity 4 Entity 4 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit I
Molecular weight formula_weight	22444.8 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MKFLNQITNYAKEAVQSAKYIGQGLSVTFDHMRRRPITVQYPYEKLIPSERFRGRIHFEFDKCIACEVCVRVCPINLPVVDWVFNKELKKKELKHYSIDFGVCIFCANCVEYCPTNCLSVTEEYELATYDRHELNYDSVAMGRIPYKVTQDPMVTPIREFAYLPAGVMSGHDLPAGAQRAGERPEAIANTAKSSEN

Entity 5 Entity 5 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit N
Molecular weight formula_weight	16656.2 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MGLLAGYQFVKDLESAGALALFVPPEGGFEGRYQRRLRSKGYTTLPMSAPGLGDLAAYLTQEHGIRPAHTGKEDIRVYFQPPLVTYHLENLPPNAKGLVLWLIDGKRLSKQEFAYLAQLTQTLPKFKVVVEVGGDRVVRWEPLADWVAAA

Entity 6 Entity 6 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit L
Molecular weight formula_weight	8575.1 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAVSTELLVLGVYGALAGLYLLVVPAIVYAYLNARWYVASSFERAFMYFLVTFFFPGLLLLAPFINFRPQPRSLNS

Entity 7 Entity 7 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit M
Molecular weight formula_weight	12584.1 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLLKSTTRHVHIYAGHVVDGEVHPDTETLTLNVDPDNELEWNEAALAKVEAKFRELVANAAGEDLTEYNLRRIGSDLEHFIRSLLMQGEIGYNLNSRVRNYSLGIPRVNHS

Entity 8 Entity 8 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit O
Molecular weight formula_weight	7877.1 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAIKKGDLVKVVAEKLANSLEALASDHRYPPYLFEGRGEVVDIRGDYAQIKFPVPTPTVWLRLDQLEVAQ

Entity 9 Entity 9 polymer

Description description	Tlr0636 protein
Molecular weight formula_weight	12462.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MIRPIADTYPLLPLSKAQMGQRQEIINSHKRLWDKTMATDLIMTILPGMTVKVTNPNDTYYQFQGIVQRITDGKVAVLFEGGNWDKLVTFQASELEPVVVTPKEKAKAKK

Entity 10 Entity 10 polymer

Description description	NdhA
Molecular weight formula_weight	40157.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MESXXXXXXXXXXXXXXXXXXXXXAKLLWLPLPMLMMLIVATVGVLVAVWLERKISAAVQQRIGPEYIGPLGILAPLADGLKLIFKEDVLPANSDRWLFTLGPAVVVIPVFLSYIIVPFGQNLLISNLAMGVFLWIALSSIAPIGLLMAGYASNNKYSLLGGLRAAAQSISYEIPLALAVLAVAMMSNGLGTVEIVEQQSQYGILSWNVWRQPIGFLVFWIAALAECERLPFDLPEAEEELVAGYQTEYAGMKFALFYLGAYVNLVLSALLVSVLYFGGWSFPIPLETIANLLGVSETNPFLQIAFAVLGITMTLIKAYFFVFLAILLRWTVPRVRIDQLLDLGWKFLLPVGLVNLLLTAGLKLAFPVAFGG

Entity 11 Entity 11 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 3
Molecular weight formula_weight	15013.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MVAIPRLRDTATVFVLSGYEYFLGFLIICSLVPVLALAASALLRPKSGRMIRLTTYESGMEPIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALVYAWRKRALEWS

Entity 12 Entity 12 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 4L
Molecular weight formula_weight	11140.3 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MQLTYVLILAALLFCIGIYGLVTSRNAVRVLMSIELLLNAVNLNLIGFANYLDGQQIKGQVFAVFVITVAAAEAAVGLAIILAIYRNRDTVDMEKFNLLKW

Entity 13 Entity 13 polymer

Description description	Proton-translocating NADH-quinone dehydrogenase subunit P NdhP
Molecular weight formula_weight	4878.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDAVISVKPILLAMTPVFILLCLFFGTRNGFYDTDQYHGNGSAH

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase subunit 5
Molecular weight formula_weight	72025.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MEPLYQYAWLIPVLPLLGALIVGFGLIAFSETTSKLRRPSAIFIMALMAIAMGHSLTLFWSQVQGHLPYTQMIEWAAAGNLHIAMGYVIDPLAALMLVIVTTVAFLVMLYSDGYMAHDPGYVRFFAYLSLFGSSMLGLVVSPNLVQVYIFWELVGMCSYLLIGFWYDRKSAAEAAQKAFVTNRVGDFGLLLGMVGLFWATGTFDFAGMGDRLTELVNTGLLSPSLAAILAILVFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLIARMFPVFEQLPQVMTTIAWTGAFTAFMGATIAITQNDIKKSLAYSTISQLGYMVMGMGVGAYSAGLFHLMTHAYFKAMLFLGSGSVIHSMEGVVGHNPDLAQDMRYMGGLRKYMPITGATFLVGCLAISGVPPFAGFWSKDEILGAVFHANPAMWLLTWLTAGLTAFYMFRMYFMTFEGKFRNVPPERQEHHDHHSHHAAVPHESPWTMTLPLVVLAIPSTLIGFVGTPFNNLFEVFIHAPGEEKVAEHAVDLTEFLILGGSSVGIGLMGITVAYLMYLKGTPSPQAIAKAIQPLYQFSLHKWYFDELYEAVFIKGCRRLARQVLEVDYNVVDGVVNLTGFVTMVTGEGLKYLQNGRAQFYALIVLLAVLGFVIFSVQT

Entity 15 Entity 15 polymer

Description description	NAD(P)H-quinone oxidoreductase chain 4 1
Molecular weight formula_weight	57847.5 kDa
EC 编号 ec_number	1.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSTFPWLTTIILFPIVAALAIPFIPDPTGKGRPIRWYALAVGLIDFALIVYAFTNFYDLNTPGMQLWESYDWIPEIGLRWSVGADGLSMPLILLTGFITTLAILAAWPVTLKPRLFYFLMLAMYGGQIAVFAVQDMLVFFLAWELELIPVYLLLAIWGGHKRQYAATKFILYTAGSSLFILVAGLAMAFYGDTVSFDMQTLAAKDYALGFQLLVYAGFLVAYGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNVDMLPAAHAKFAPVLVILGVVNIIYAALTSYAQRNLKRKIAYSSISHIGFVLIGIASFTNLGMSGAVLQMVSHGLIGASLFFLVGATYDRTHTLILEEMGGVGQKMKKIFAMFTACSLASLALPGMSGFVAELMVFIGFATSDAYSLPFRVIVVFLAAVGVILTPIYLLSMLREIFYGPENKELVEHEALVDAEPREVFIIACLLVPIIGIGLYPKLLTQIYDATTGQVIARAREVLPTLAQQTEQPLGILPMVAPQLKANAQ

Entity 16 Entity 16 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 2
Molecular weight formula_weight	55168.5 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDLVTLAGQLNAGTILPETILIVTLLVVLLADLIQGRQADRWTPYFAIVGLGGAIATMIPLWTQPATISFFGSFISDHLSLFFRGLIALSALGTILMSIRYVEQTGSSLGEFMTILLTATVGGMFIAGAQELVFIFVALETLSIASYLLTGYTKRDSRSNEAALKYLLIGAASSAIFLYGSSLLYGLSGGHTQLPAIAQALSSESLGLVVALVFVIAGISFKISAVPFHQWTPDVYEGAPTPVVAFLSVGSKAAGFALAIRFLTLAFPSVTDQWQLIFTVLAILSMILGNVVALAQTSMKRMLAYSSIGQAGFVMIGFVVGTEAGYASMLFYLLVYLFMNLGAFTCVILFSLRTGTDQISEYAGLYQKDPLLTLGLSLCLLSLGGIPPLAGFFGKIYLFWAGWQAGAYGLVLLGLLTSVISIYYYIRVVKMMVVKEPQEMSEAVRNYPEVSWSSFGLRPLQVGLVMTVIATSLAGILANPLFNLVNTAVWDVPQLANQPTVMEVAYQALSPAGKS

Entity 17 Entity 17 polymer

Description description	NADH-quinone oxidoreductase subunit J
Molecular weight formula_weight	21580.6 kDa
EC 编号 ec_number	1.6.5.11
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDLATLTQTITFFALAAAVIIAALGVVLLDNVVYSAFLLGGVFLSIAGLYILMNADFVSAAQILIYVGAVNVLILFAIMLVNKRETYTPVPGRWLRQGGAAVVSLGVFALLTKMILQTPWQLSSVPPTPDSITTIGQHFFSDFLLPFELASVLLLMALIGAVVLARRELVLEPEPILGEEVVPPLELPERPREPVALSEK

Entity 18 Entity 18 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6nbqd_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.72 — Antiporter-like subunits from respiratory complex I
Superfamily Superfamily superfamily	f.72.1 — Antiporter-like subunits from respiratory complex I
Family Family family	f.72.1.0 — automated matches

Domain ID domain_id	d6nbqh_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	6nbqE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3510 —

Domain ID domain_id	6nbqG01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

Domain ID domain_id	6nbqH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	6nbqS00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	140 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	81670

T.elongatus NDH (data-set 1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

NAD(P)H-quinone oxidoreductase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit O

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tlr0636 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer