6ndd

RHODOCETIN IN COMPLEX WITH THE INTEGRIN ALPHA2-A DOMAIN WITH MANGANESE BOUND

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Snaclec rhodocetin subunit gamma

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit delta × 1 （D2YW40） Integrin alpha-2 × 1 （P17301） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit delta × 1 （D2YW40） Integrin alpha-2 × 1 （P17301） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1 AMMONIUM ION × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit delta × 1 （D2YW40） Integrin alpha-2 × 1 （P17301） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit delta × 1 （D2YW40） Integrin alpha-2 × 1 （P17301） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 3 water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit delta × 1 （D2YW40） Integrin alpha-2 × 1 （P17301） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit delta × 1 （D2YW40） Integrin alpha-2 × 1 （P17301） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SLEC_CALRH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–135； UniProt 1–135 Author chain D； PDBConstruct 1–135； UniProt 1–135 Author chain G； PDBConstruct 1–135； UniProt 1–135 Author chain J； PDBConstruct 1–135； UniProt 1–135 Author chain M； PDBConstruct 1–135； UniProt 1–135 Author chain P； PDBConstruct 1–135； UniProt 1–135

Snaclec rhodocetin subunit delta

OrganismNot specified

UniProt D2YW40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Integrin alpha-2 × 1 （P17301） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Integrin alpha-2 × 1 （P17301） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1 AMMONIUM ION × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Integrin alpha-2 × 1 （P17301） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Integrin alpha-2 × 1 （P17301） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 3 water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Integrin alpha-2 × 1 （P17301） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Integrin alpha-2 × 1 （P17301） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SLED_CALRH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–124； UniProt 1–124 Author chain E； PDBConstruct 1–124； UniProt 1–124 Author chain H； PDBConstruct 1–124； UniProt 1–124 Author chain K； PDBConstruct 1–124； UniProt 1–124 Author chain N； PDBConstruct 1–124； UniProt 1–124 Author chain Q； PDBConstruct 1–124； UniProt 1–124

Integrin alpha-2

Homo sapiens

UniProt P17301

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Snaclec rhodocetin subunit delta × 1 （D2YW40） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Snaclec rhodocetin subunit delta × 1 （D2YW40） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1 AMMONIUM ION × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Snaclec rhodocetin subunit delta × 1 （D2YW40） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Snaclec rhodocetin subunit delta × 1 （D2YW40） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 3 water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Snaclec rhodocetin subunit delta × 1 （D2YW40） SULFATE ION × 2 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Snaclec rhodocetin subunit gamma × 1 （D2YW39） Snaclec rhodocetin subunit delta × 1 （D2YW40） SULFATE ION × 3 MANGANESE (II) ION × 1 SODIUM ION × 1 CHLORIDE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ITA2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 21–217； UniProt 170–366 Author chain F； PDBConstruct 21–217； UniProt 170–366 Author chain I； PDBConstruct 21–217； UniProt 170–366 Author chain L； PDBConstruct 21–217； UniProt 170–366 Author chain O； PDBConstruct 21–217； UniProt 170–366 Author chain R； PDBConstruct 21–217； UniProt 170–366

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ndd
Deposition date deposition_date	2018-12-13
Structure title title	RHODOCETIN IN COMPLEX WITH THE INTEGRIN ALPHA2-A DOMAIN WITH MANGANESE BOUND
Keywords keywords	C-TYPE LECTIN, INTEGRIN, VENOM, COAGULATION, CELL ADHESION, MANGANESE, CELL ADHESION-TOXIN complex; CELL ADHESION/TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ndd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ndd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ndd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.21 Å
Rg (electron density)	24.36 Å
Total Rg	25.24 Å
Atom count	3599
Residues	444
Excluded volume	63681 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ndd__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6ndd__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6ndd__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6ndd__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`6ndd__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`6ndd__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Snaclec rhodocetin subunit gamma
Molecular weight formula_weight	15741.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P
Atom count atom_count	21590

DFNCLPGWSAYDQHCYQAFNEPKTWDEAERFCTEQAKRGHLVSIGSDGEADFVAQLVTNNIKRPELYVWIGLRDRRKEQQCSSEWSMSASIIYVNWNTGESQMCQGLARWTGFRKWDYSDCQAKNPFVCKFPSEC

Entity 2 Entity 2 polymer

Description description	Snaclec rhodocetin subunit delta
Molecular weight formula_weight	14876.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q

CPLHWSSYNGYCYRVFSELKTWEDAESFCYAQHKGSRLASIHSREEEAFVGKLASQTLKYTSMWLGLNNPWKECKWEWSDDAKLDYKVWLRRPYCAVMVVKTDRIFWFNRGCEKTVSFVCKFYS

Entity 3 Entity 3 polymer

Description description	Integrin alpha-2
Molecular weight formula_weight	23737.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R

MGSSHHHHHHSSGLVPRGGSPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 5 Entity 5 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 8 Entity 8 non-polymer

Description description	AMMONIUM ION
Molecular weight formula_weight	18.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (18 domains)

Domain ID domain_id	d6ndda_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

Domain ID domain_id	d6nddd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6ndde_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddf_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

Domain ID domain_id	d6nddg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddi_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

Domain ID domain_id	d6nddj_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddl_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

Domain ID domain_id	d6nddm_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddo_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

Domain ID domain_id	d6nddp_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddq_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d6nddr_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

CATH v4.4 (18 domains)

Domain ID domain_id	6nddA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

Domain ID domain_id	6nddD00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddE00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

Domain ID domain_id	6nddG00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddH00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddI00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

Domain ID domain_id	6nddJ00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddK00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddL00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

Domain ID domain_id	6nddM00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddN00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddO00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

Domain ID domain_id	6nddP00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddQ00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	6nddR00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

▶

Unit-cell length a length_a	130.712 Å
Unit-cell length b length_b	130.712 Å
Unit-cell length c length_c	251.800 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 41
Space-group number int_tables_number	76
Crystal system crystal_system	—

Resolution resolution	3.050 Å
Low-resolution limit resolution_low	48.010 Å
R factor r_factor	0.2197
R_work r_work	0.2169
R_free r_free	0.2735

RHODOCETIN IN COMPLEX WITH THE INTEGRIN ALPHA2-A DOMAIN WITH MANGANESE BOUND

1. Protein Identity and Related Structures Protein Identity & Related Structures

Snaclec rhodocetin subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Snaclec rhodocetin subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Integrin alpha-2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ndd__assembly_1__model_1

6ndd__assembly_1__model_1 | I(q)

6ndd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (18 domains)

CATH v4.4 (18 domains)

7. Citations (1)

RHODOCETIN IN COMPLEX WITH THE INTEGRIN ALPHA2-A DOMAIN WITH MANGANESE BOUND

1. Protein Identity and Related Structures Protein Identity & Related Structures

Snaclec rhodocetin subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Snaclec rhodocetin subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Integrin alpha-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ndd__assembly_1__model_1

6ndd__assembly_1__model_1 | I(q)

6ndd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (18 domains)

CATH v4.4 (18 domains)

7. Citations (1)