SAXSdb — 6nm5

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type IV conjugative transfer system pilin TraA

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 76	Maturation protein × 1 （P03610） (2R)-2,3-dihydroxypropyl ethyl hydrogen (S)-phosphate × 70	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1Y2ZDR2_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–65； UniProt 30–94 Author chain 1B； PDBConstruct 1–65； UniProt 30–94 Author chain 1C； PDBConstruct 1–65； UniProt 30–94 Author chain 1D； PDBConstruct 1–65； UniProt 30–94 Author chain 1E； PDBConstruct 1–65； UniProt 30–94 Author chain 1F； PDBConstruct 1–65； UniProt 30–94 Author chain 1G； PDBConstruct 1–65； UniProt 30–94 Author chain 1H； PDBConstruct 1–65； UniProt 30–94 Author chain 1I； PDBConstruct 1–65； UniProt 30–94 Author chain 1J； PDBConstruct 1–65； UniProt 30–94 Author chain 1K； PDBConstruct 1–65； UniProt 30–94 Author chain 1L； PDBConstruct 1–65； UniProt 30–94 Author chain 1M； PDBConstruct 1–65； UniProt 30–94 Author chain 1N； PDBConstruct 1–65； UniProt 30–94 Author chain 1O； PDBConstruct 1–65； UniProt 30–94 Author chain 2A； PDBConstruct 1–65； UniProt 30–94 Author chain 2B； PDBConstruct 1–65； UniProt 30–94 Author chain 2C； PDBConstruct 1–65； UniProt 30–94 Author chain 2D； PDBConstruct 1–65； UniProt 30–94 Author chain 2E； PDBConstruct 1–65； UniProt 30–94 Author chain 2F； PDBConstruct 1–65； UniProt 30–94 Author chain 2G； PDBConstruct 1–65； UniProt 30–94 Author chain 2H； PDBConstruct 1–65； UniProt 30–94 Author chain 2I； PDBConstruct 1–65； UniProt 30–94 Author chain 2J； PDBConstruct 1–65； UniProt 30–94 Author chain 2K； PDBConstruct 1–65； UniProt 30–94 Author chain 2L； PDBConstruct 1–65； UniProt 30–94 Author chain 2M； PDBConstruct 1–65； UniProt 30–94 Author chain 2N； PDBConstruct 1–65； UniProt 30–94 Author chain 2O； PDBConstruct 1–65； UniProt 30–94 Author chain 3A； PDBConstruct 1–65； UniProt 30–94 Author chain 3B； PDBConstruct 1–65； UniProt 30–94 Author chain 3C； PDBConstruct 1–65； UniProt 30–94 Author chain 3D； PDBConstruct 1–65； UniProt 30–94 Author chain 3E； PDBConstruct 1–65； UniProt 30–94 Author chain 3F； PDBConstruct 1–65； UniProt 30–94 Author chain 3G； PDBConstruct 1–65； UniProt 30–94 Author chain 3H； PDBConstruct 1–65； UniProt 30–94 Author chain 3I； PDBConstruct 1–65； UniProt 30–94 Author chain 3J； PDBConstruct 1–65； UniProt 30–94 Author chain 3K； PDBConstruct 1–65； UniProt 30–94 Author chain 3L； PDBConstruct 1–65； UniProt 30–94 Author chain 3M； PDBConstruct 1–65； UniProt 30–94 Author chain 3N； PDBConstruct 1–65； UniProt 30–94 Author chain 3O； PDBConstruct 1–65； UniProt 30–94 Author chain 4A； PDBConstruct 1–65； UniProt 30–94 Author chain 4B； PDBConstruct 1–65； UniProt 30–94 Author chain 4C； PDBConstruct 1–65； UniProt 30–94 Author chain 4D； PDBConstruct 1–65； UniProt 30–94 Author chain 4E； PDBConstruct 1–65； UniProt 30–94 Author chain 4F； PDBConstruct 1–65； UniProt 30–94 Author chain 4G； PDBConstruct 1–65； UniProt 30–94 Author chain 4H； PDBConstruct 1–65； UniProt 30–94 Author chain 4I； PDBConstruct 1–65； UniProt 30–94 Author chain 4J； PDBConstruct 1–65； UniProt 30–94 Author chain 4K； PDBConstruct 1–65； UniProt 30–94 Author chain 4L； PDBConstruct 1–65； UniProt 30–94 Author chain 4M； PDBConstruct 1–65； UniProt 30–94 Author chain 4N； PDBConstruct 1–65； UniProt 30–94 Author chain 4O； PDBConstruct 1–65； UniProt 30–94 Author chain 5A； PDBConstruct 1–65； UniProt 30–94 Author chain 5B； PDBConstruct 1–65； UniProt 30–94 Author chain 5C； PDBConstruct 1–65； UniProt 30–94 Author chain 5D； PDBConstruct 1–65； UniProt 30–94 Author chain 5E； PDBConstruct 1–65； UniProt 30–94 Author chain 5F； PDBConstruct 1–65； UniProt 30–94 Author chain 5G； PDBConstruct 1–65； UniProt 30–94 Author chain 5H； PDBConstruct 1–65； UniProt 30–94 Author chain 5I； PDBConstruct 1–65； UniProt 30–94 Author chain 5J； PDBConstruct 1–65； UniProt 30–94 Author chain 5K； PDBConstruct 1–65； UniProt 30–94 Author chain 5L； PDBConstruct 1–65； UniProt 30–94 Author chain 5M； PDBConstruct 1–65； UniProt 30–94 Author chain 5N； PDBConstruct 1–65； UniProt 30–94 Author chain 5O； PDBConstruct 1–65； UniProt 30–94

Maturation protein

OrganismNot specified

UniProt P03610

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 76	Type IV conjugative transfer system pilin TraA × 75 （A0A1Y2ZDR2） (2R)-2,3-dihydroxypropyl ethyl hydrogen (S)-phosphate × 70	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MAT_BPMS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain M； PDBConstruct 1–393； UniProt 1–393

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6nm5
Deposition date deposition_date	2019-01-10
Structure title title	F-pilus/MS2 Maturation protein complex
Keywords keywords	MS2 maturation protein, F-pilus, adsorption complex, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6nm5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6nm5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6nm5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.57 Å
Rg (electron density)	65.90 Å
Total Rg	65.83 Å
Atom count	39163
Residues	5207
Excluded volume	733170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6nm5__assembly_1__model_1`	76-meric （76）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Type IV conjugative transfer system pilin TraA
Molecular weight formula_weight	6831.2 kDa
Source method src_method	nat
Copy count entity_count	75

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;1A,1B,1C,1D,1E,1F,1G,1H,1I,1J,1K,1L,1M,1N,1O,2A,2B,2C,2D,2E,2F,2G,2H,2I,2J,2K,2L,2M,2N,2O,3A,3B,3C,3D,3E,3F,3G,3H,3I,3J,3K,3L,3M,3N,3O,4A,4B,4C,4D,4E,4F,4G,4H,4I,4J,4K,4L,4M,4N,4O,5A,5B,5C,5D,5E,5F,5G,5H,5I,5J,5K,5L,5M,5N,5O ;
Atom count atom_count	39224

QDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL

Entity 2 Entity 2 polymer

Description description	Maturation protein
Molecular weight formula_weight	44030.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MRAFSTLDRENETFVPSVRVYADGETEDNSFSLKYRSNWTPGRFNSTGAKTKQWHYPSPYSRGALSVTSIDQGAYKRSGSSWGRPYEEKAGFGFSLDARSCYSLFPVSQNLTYIEVPQNVANRASTEVLQKVTQGNFNLGVALAEARSTASQLATQTIALVKAYTAARRGNWRQALRYLALNEDRKFRSKHVAGRWLELQFGWLPLMSDIQGAYEMLTKVHLQEFLPMRAVRQVGTNIKLDGRLSYPAANFQTTCNISRRIVIWFYINDARLAWLSSLGILNPLGIVWEKVPFSFVVDWLLPVGNMLEGLTAPVGCSYMSGTVTDVITGESIISVDAPYGWTVERQGTAKAQISAMHRGVQSVWPTTGAYVKSPFSMVHTLDALALIRQRLSR

Entity 3 Entity 3 non-polymer

Description description	(2R)-2,3-dihydroxypropyl ethyl hydrogen (S)-phosphate
Molecular weight formula_weight	200.1 kDa
Source method src_method	syn
Copy count entity_count	70

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	6.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	168989

F-pilus/MS2 Maturation protein complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type IV conjugative transfer system pilin TraA

State in the Current Structure

Other States of the Same Protein in the Database

Maturation protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6nm5__assembly_1__model_1

6nm5__assembly_1__model_1 | I(q)

6nm5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)

F-pilus/MS2 Maturation protein complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type IV conjugative transfer system pilin TraA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Maturation protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6nm5__assembly_1__model_1

6nm5__assembly_1__model_1 | I(q)

6nm5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)