SAXSdb — 6oei

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator

Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	(4S)-2-METHYL-2,4-PENTANEDIOL × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPC42_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–124； UniProt 11–130

Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator

Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

UniProt Q8KG60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	(4S)-2-METHYL-2,4-PENTANEDIOL × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KG60_CHLTE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 125–298； UniProt 30–203

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6oei
Deposition date deposition_date	2019-03-27
Structure title title	Yeast Spc42 N-terminal coiled-coil fused to PDB: 3K2N
Keywords keywords	Yeast Centrosome, Coiled-Coil, Spindle Pole Body, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6oei__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6oei__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6oei__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.06 Å
Rg (electron density)	41.19 Å
Total Rg	40.63 Å
Atom count	3916
Residues	480
Excluded volume	70502 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6oei__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator
Molecular weight formula_weight	34148.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2008

GGSGSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDANSALKLMQYIGDAIGTIRDPQELFRTVTDKLRLLFAFDSAVIITIDRERREASVFFEMLRFELPEQLRHQTRSIAGTWLEGHLDDRTVTVASIARDIPSFGADGAPLLWTLHELGMRQIVLSPLRSGGRVIGFLSFVSAEEKLWSDGDKSLLSGVSSSIAIAVSNALAYEALRQRE

Source Source

Source organism organism	Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
NCBI taxonomy ID ncbi_taxonomy_id	194439
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	(4S)-2-METHYL-2,4-PENTANEDIOL
Molecular weight formula_weight	118.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	41

▶

Unit-cell length a length_a	49.664 Å
Unit-cell length b length_b	193.108 Å
Unit-cell length c length_c	95.842 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.580 Å
Low-resolution limit resolution_low	36.378 Å
R factor r_factor	0.2101
R_work r_work	0.2082
R_free r_free	0.2438

Yeast Spc42 N-terminal coiled-coil fused to PDB: 3K2N

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator

State in the Current Structure

Other States of the Same Protein in the Database

Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6oei__assembly_1__model_1

6oei__assembly_1__model_1 | I(q)

6oei__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Yeast Spc42 N-terminal coiled-coil fused to PDB: 3K2N

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spindle pole body component SPC42,Sigma-54-dependent transcriptional regulator

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6oei__assembly_1__model_1

6oei__assembly_1__model_1 | I(q)

6oei__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)