SAXSdb — 6pfk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PHOSPHOFRUCTOKINASE

Geobacillus stearothermophilus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	2-PHOSPHOGLYCOLIC ACID × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K6PF_BACST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–319； UniProt 1–319 Author chain B； PDBConstruct 1–319； UniProt 1–319 Author chain C； PDBConstruct 1–319； UniProt 1–319 Author chain D； PDBConstruct 1–319； UniProt 1–319

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6pfk
Deposition date deposition_date	1996-01-04
Structure title title	PHOSPHOFRUCTOKINASE, INHIBITED T-STATE
Keywords keywords	TRANSFERASE, KINASE, GLYCOLYSIS; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6pfk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6pfk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6pfk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.24 Å
Rg (electron density)	30.28 Å
Total Rg	30.96 Å
Atom count	9431
Residues	1276
Excluded volume	166470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6pfk__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PHOSPHOFRUCTOKINASE
Molecular weight formula_weight	34167.9 kDa
EC 编号 ec_number	2.7.1.11
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	9681

MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI

Source Source

Source organism organism	Geobacillus stearothermophilus
NCBI taxonomy ID ncbi_taxonomy_id	1422
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	2-PHOSPHOGLYCOLIC ACID
Molecular weight formula_weight	156.0 kDa
Source method src_method	man
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	226

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6pfka_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.89 — Phosphofructokinase
Superfamily Superfamily superfamily	c.89.1 — Phosphofructokinase
Family Family family	c.89.1.1 — Phosphofructokinase

Domain ID domain_id	d6pfkb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.89 — Phosphofructokinase
Superfamily Superfamily superfamily	c.89.1 — Phosphofructokinase
Family Family family	c.89.1.1 — Phosphofructokinase

Domain ID domain_id	d6pfkc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.89 — Phosphofructokinase
Superfamily Superfamily superfamily	c.89.1 — Phosphofructokinase
Family Family family	c.89.1.1 — Phosphofructokinase

Domain ID domain_id	d6pfkd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.89 — Phosphofructokinase
Superfamily Superfamily superfamily	c.89.1 — Phosphofructokinase
Family Family family	c.89.1.1 — Phosphofructokinase

CATH v4.4 (8 domains)

Domain ID domain_id	6pfkA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	450 —

Domain ID domain_id	6pfkA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	460 — Phosphofructokinase domain

Domain ID domain_id	6pfkB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	450 —

Domain ID domain_id	6pfkB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	460 — Phosphofructokinase domain

Domain ID domain_id	6pfkC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	450 —

Domain ID domain_id	6pfkC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	460 — Phosphofructokinase domain

Domain ID domain_id	6pfkD01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	450 —

Domain ID domain_id	6pfkD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	460 — Phosphofructokinase domain

▶

Unit-cell length a length_a	132.000 Å
Unit-cell length b length_b	115.200 Å
Unit-cell length c length_c	96.200 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	—
R_work r_work	0.1880
R_free r_free	0.2550

PHOSPHOFRUCTOKINASE, INHIBITED T-STATE

1. Protein Identity and Related Structures Protein Identity & Related Structures

PHOSPHOFRUCTOKINASE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6pfk__assembly_1__model_1

6pfk__assembly_1__model_1 | I(q)

6pfk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

CATH v4.4 (8 domains)

7. Citations (1)

PHOSPHOFRUCTOKINASE, INHIBITED T-STATE

1. Protein Identity and Related Structures Protein Identity & Related Structures

PHOSPHOFRUCTOKINASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6pfk__assembly_1__model_1

6pfk__assembly_1__model_1 | I(q)

6pfk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

CATH v4.4 (8 domains)

7. Citations (1)