SAXSdb — 6ps8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	N-[2-(5-methoxy-2-phenyl-1H-indol-3-yl)ethyl]acetamide × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTR1A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–209； UniProt 12–218 Author chain A； PDBConstruct 406–503； UniProt 228–325

Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase

Homo sapiens

UniProt Q9V2J8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	N-[2-(5-methoxy-2-phenyl-1H-indol-3-yl)ethyl]acetamide × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9V2J8_PYRAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 210–405； UniProt 218–413

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ps8
Deposition date deposition_date	2019-07-12
Structure title title	XFEL MT1R structure by ligand exchange from agomelatine to 2-phenylmelatonin.
Keywords keywords	GPCR, COMPLEX-LCP method, SBDD, drug design, XFEL, LCP-SFX, Ligand Exchange, Agomelatine, 2-phenyl melatonin, MEMBRANE PROTEIN, MT1; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ps8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ps8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ps8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.71 Å
Rg (electron density)	29.86 Å
Total Rg	30.34 Å
Atom count	3671
Residues	485
Excluded volume	66341 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ps8__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase
Molecular weight formula_weight	56597.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3671

GTSQPVLRGDGARPSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLAVANLVVAIYPYPLVLMSIFNNGWNFGYLHCQVSAFLMGLSVIGSIWNITGIAIDRYLYICHSLKYDKLYSSKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRIWILVLQVRGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSKLKPQDFRNFVTMFVVFVLFAICFAPLNFIGLAVASDPASMVPRIPEWLFVASYYMAYFNSCLNPIIYGLLDQNFRKEYRRIIVSLCTARVFFVDSSN

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 non-polymer

Description description	N-[2-(5-methoxy-2-phenyl-1H-indol-3-yl)ethyl]acetamide
Molecular weight formula_weight	308.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	122.200 Å
Unit-cell length b length_b	122.200 Å
Unit-cell length c length_c	122.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2609
R_work r_work	0.2585
R_free r_free	0.3075

XFEL MT1R structure by ligand exchange from agomelatine to 2-phenylmelatonin.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase

State in the Current Structure

Other States of the Same Protein in the Database

Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ps8__assembly_1__model_1

6ps8__assembly_1__model_1 | I(q)

6ps8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

7. Citations (1)

XFEL MT1R structure by ligand exchange from agomelatine to 2-phenylmelatonin.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion protein of Melatonin receptor type 1A and GlgA glycogen synthase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ps8__assembly_1__model_1

6ps8__assembly_1__model_1 | I(q)

6ps8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

7. Citations (1)