6pv8

Human alpha3beta4 nicotinic acetylcholine receptor in complex with AT-1001

Method: ELECTRON MICROSCOPY D_max: 183.8 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Neuronal acetylcholine receptor subunit alpha-3 and Soluble cytochrome b562

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 9 其他Polymer 10 PDB declaration: nonameric（9） Consistent with protein copy count	Chain A； UniProt 23–127 Chain B； UniProt 23–127 Chain C； UniProt 23–127 Chain D； UniProt 23–127 Chain E； UniProt 23–127	Not recorded	IgG2b Fab heavy chain × 2 Kappa Fab light chain × 2 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 P1M (3-endo)-N-(2-bromophenyl)-9-methyl-9-azabicyclo[3.3.1]nonan-3-amine × 2 Y01 CHOLESTEROL HEMISUCCINATE × 10 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 NA SODIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE；4 second blot	Resolution 3.87 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6PV8	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6PV7 Human alpha3beta4 nicotinic acetylcholine receptor in complex with nicotine Deposited 2019-07-19	Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 23–127（105 aa） Chain B 23–127（105 aa） Chain C 23–127（105 aa） Chain D 23–127（105 aa） Chain E 23–127（105 aa）	Not recorded	NCT (S)-3-(1-METHYLPYRROLIDIN-2-YL)PYRIDINE × 2 Y01 CHOLESTEROL HEMISUCCINATE × 10 NA SODIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 DD9 nonane × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；4 second blot	Resolution 3.34 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A3W4NZ06_ECOLX
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 348–452； UniProt 23–127 Author chain D； PDBConstruct 348–452； UniProt 23–127 Author chain B； PDBConstruct 341–445； UniProt 23–127 Author chain C； PDBConstruct 341–445； UniProt 23–127 Author chain E； PDBConstruct 341–445； UniProt 23–127

Fusion protein of Neuronal acetylcholine receptor subunit alpha-3 and Soluble cytochrome b562

Homo sapiens

UniProt P32297

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 9 其他Polymer 10 PDB declaration: nonameric（9） Consistent with protein copy count	Chain A； UniProt 32–378 Chain A； UniProt 434–505 Chain D； UniProt 32–378 Chain D； UniProt 434–505	Not recorded	Fusion protein of Neuronal acetylcholine receptor subunit beta-4 and Soluble cytochrome b562 × 3 （P30926,A0A3W4NZ06） IgG2b Fab heavy chain × 2 Kappa Fab light chain × 2 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 P1M (3-endo)-N-(2-bromophenyl)-9-methyl-9-azabicyclo[3.3.1]nonan-3-amine × 2 Y01 CHOLESTEROL HEMISUCCINATE × 10 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 NA SODIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE；4 second blot	Resolution 3.87 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6PV8	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4ZK4 Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy-pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane Deposited 2015-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain B 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain C 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain D 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain E 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 5 PG4 TETRAETHYLENE GLYCOL × 1 TII (5R)-1-methyl-7-[5-(propan-2-yloxy)pyridin-3-yl]-1,7-diazaspiro[4.4]nonane × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；1.7% PEG400, 0.085 M HEPES sodium, pH 7.5, 1.7 M ammonium sulfate, 15% glycerol	Resolution 1.90 Å R-free 0.212
5SYO Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with Cytisine Deposited 2016-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain B 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain C 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain D 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain E 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens	Not recorded	C5E (1R,5S)-1,2,3,4,5,6-HEXAHYDRO-8H-1,5-METHANOPYRIDO[1,2-A][1,5]DIAZOCIN-8-ONE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；1.7% PEG 400, 0.085 M HEPES - Na pH 7.5, 1.7 M Ammonium Sulfate, 15% Glycerol	Resolution 2.00 Å R-free 0.227
5TVC Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with (E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine (TI-5312) Deposited 2016-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain B 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain C 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain D 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens Chain E 215–230（16 aa） Fragment：UNP residues 18-198 + 215-236 from Aplysia californica linked by loop C (UNP residues 215-230) from Homo sapiens	Not recorded	SO4 SULFATE ION × 6 1PE PENTAETHYLENE GLYCOL × 1 7LB (E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；313 K；1.7% PEG 400, 0.085 M HEPES - Na pH 7.5, 1.7 M Ammonium Sulfate, 15% Glycerol	Resolution 1.93 Å R-free 0.225
6PV7 Human alpha3beta4 nicotinic acetylcholine receptor in complex with nicotine Deposited 2019-07-19	Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 32–378（347 aa） Chain A 434–505（72 aa） Chain D 32–378（347 aa） Chain D 434–505（72 aa）	Not recorded	NCT (S)-3-(1-METHYLPYRROLIDIN-2-YL)PYRIDINE × 2 Y01 CHOLESTEROL HEMISUCCINATE × 10 NA SODIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 DD9 nonane × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；4 second blot	Resolution 3.34 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACHA3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–347； UniProt 32–378 Author chain A； PDBConstruct 454–525； UniProt 434–505 Author chain D； PDBConstruct 1–347； UniProt 32–378 Author chain D； PDBConstruct 454–525； UniProt 434–505

Fusion protein of Neuronal acetylcholine receptor subunit beta-4 and Soluble cytochrome b562

Homo sapiens

UniProt P30926

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 9 其他Polymer 10 PDB declaration: nonameric（9） Consistent with protein copy count	Chain B； UniProt 22–361 Chain B； UniProt 417–498 Chain C； UniProt 22–361 Chain C； UniProt 417–498 Chain E； UniProt 22–361 Chain E； UniProt 417–498	Not recorded	Fusion protein of Neuronal acetylcholine receptor subunit alpha-3 and Soluble cytochrome b562 × 2 （P32297,A0A3W4NZ06） IgG2b Fab heavy chain × 2 Kappa Fab light chain × 2 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 5 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 P1M (3-endo)-N-(2-bromophenyl)-9-methyl-9-azabicyclo[3.3.1]nonan-3-amine × 2 Y01 CHOLESTEROL HEMISUCCINATE × 10 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 NA SODIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE；4 second blot	Resolution 3.87 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6PV8	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6PV7 Human alpha3beta4 nicotinic acetylcholine receptor in complex with nicotine Deposited 2019-07-19	Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 22–361（340 aa） Chain B 417–498（82 aa） Chain C 22–361（340 aa） Chain C 417–498（82 aa） Chain E 22–361（340 aa） Chain E 417–498（82 aa）	Not recorded	NCT (S)-3-(1-METHYLPYRROLIDIN-2-YL)PYRIDINE × 2 Y01 CHOLESTEROL HEMISUCCINATE × 10 NA SODIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 DD9 nonane × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；4 second blot	Resolution 3.34 Å
8ZRN Structure of abt Deposited 2024-06-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–360（360 aa） Chain B 399–498（100 aa） Chain D 1–360（360 aa） Chain D 399–498（100 aa） Chain E 1–360（360 aa） Chain E 399–498（100 aa）	Not recorded	A1D8V 5-[[(2~{S})-azetidin-2-yl]methoxy]-2-chloranyl-pyridine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.25 Å
8ZRP Structure of nico Deposited 2024-06-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–360（360 aa） Chain B 399–498（100 aa） Chain D 1–360（360 aa） Chain D 399–498（100 aa） Chain E 1–360（360 aa） Chain E 399–498（100 aa）	Not recorded	NCT (S)-3-(1-METHYLPYRROLIDIN-2-YL)PYRIDINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACHB4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–340； UniProt 22–361 Author chain B； PDBConstruct 447–528； UniProt 417–498 Author chain C； PDBConstruct 1–340； UniProt 22–361 Author chain C； PDBConstruct 447–528； UniProt 417–498 Author chain E； PDBConstruct 1–340； UniProt 22–361 Author chain E； PDBConstruct 447–528； UniProt 417–498

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6pv8
Deposition date deposition_date	2019-07-19
Structure title title	Human alpha3beta4 nicotinic acetylcholine receptor in complex with AT-1001
Keywords keywords	Ligand-gated ion channel, Nicotinic acetylcholine receptor, Cys-loop receptor, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	51.45 Å
Radius of gyration Rg (electron density) rg_electron	51.02 Å
Forward intensity I(0) i0	1015970000.00
Molecular weight molecular_weight	284930.0 kDa
Excluded volume excluded_volume	364850 Å³
Envelope volume envelope_volume	515980 Å³
Hydration-shell volume shell_volume	88044 Å³
Envelope diameter envelope_diameter	194.8 Å
Shell Rg shell_rg	51.10 Å
Envelope Rg envelope_rg	51.03 Å
Shape Rg shape_rg	51.00 Å
Total Rg total_rg	51.10 Å
Total atoms total_atoms	20043
Residues n_residues	2379
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	183.8 Å
Rg (real space) rg_real	51.79 Å
Rg uncertainty (real space) rg_real_error	1.97 Å
I(0) (real space) i0_real	1.0160e+09
I(0) uncertainty (real space) i0_real_error	2.0910e+07
Rg (reciprocal space) rg_reciprocal	51.17 Å
I(0) (reciprocal space) i0_reciprocal	1015000000.0000
Solution quality estimate total_estimate	0.5872
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	53.4 Å
Skewness Skewness skewness	0.642
Kurtosis Kurtosis kurtosis	0.032
Angular range angular_range	— – 0.1550 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	107800000.0000
Real-space data points n_real_points	32
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.628; Stabil: 1.000; Sysdev: 0.029; Positv: 1.000; Valcen: 0.901; Smooth: 0.758

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Fusion protein of Neuronal acetylcholine receptor subunit alpha-3 and Soluble cytochrome b562
Molecular weight formula_weight	60087.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	20051

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Fusion protein of Neuronal acetylcholine receptor subunit beta-4 and Soluble cytochrome b562
Molecular weight formula_weight	61337.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,E

RVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAFPADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASEGPYAAQRDSAWSHPQFEK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	IgG2b Fab heavy chain
Molecular weight formula_weight	23396.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H

QVQLQQSGPELVRPGVSVKISCKGSGYTFTDYALYWVRQSHAKSLEWIGVINPYSGNTNYNQKFKGKATMTVDKSSSTAYMELARLTSDDSAIYYCASGYDGYPYTMDYWGPGASVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP

Entity 4 Entity 4 polymer

Description description	Kappa Fab light chain
Molecular weight formula_weight	23401.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,I

QIVLTQSPAIMSASPGEKVTMTCSASSSMTYMHWYQQKSGTSPKRWIYDTSQLASGVPARFRGSGSGTSFSLTISSMEAEDAATYYCQQWSSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Entity 5 Entity 5 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	2

Entity 6 Entity 6 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	5

Entity 7 Entity 7 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	3

Entity 8 Entity 8 non-polymer

Description description	(3-endo)-N-(2-bromophenyl)-9-methyl-9-azabicyclo[3.3.1]nonan-3-amine
Molecular weight formula_weight	309.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	CHOLESTEROL HEMISUCCINATE
Molecular weight formula_weight	486.7 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 10 Entity 10 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	6

Entity 11 Entity 11 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 12 Entity 12 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	8

▼

7. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	6pv8A01
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	6pv8B01
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	6pv8C01
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	6pv8D01
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

Domain ID domain_id	6pv8E01
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	170 — Acetylcholine Binding Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Neurotransmitter-gated ion-channel ligand-binding domain

▶

8. Citations (1)

▶

Resolution resolution	3.87 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	93080

fit	/app/data/saxs_computation/pv/6pv8/6pv8.fit
pddf	/app/data/pr_computation/pv/6pv8/6pv8.pr.out
profile	/app/data/saxs_computation/pv/6pv8/6pv8.dat

Human alpha3beta4 nicotinic acetylcholine receptor in complex with AT-1001

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion protein of Neuronal acetylcholine receptor subunit alpha-3 and Soluble cytochrome b562

State in the Current Structure

Other States of the Same Protein in the Database

Fusion protein of Neuronal acetylcholine receptor subunit alpha-3 and Soluble cytochrome b562

State in the Current Structure

Other States of the Same Protein in the Database

Fusion protein of Neuronal acetylcholine receptor subunit beta-4 and Soluble cytochrome b562

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 branched

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 water

7. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)