SAXSdb — 6qh0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hsRosR DNA binding protein

Halobacterium salinarum NRC-1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 2 DNA 2	DNA (28-MER) × 1 DNA (28-MER) × 1 SULFATE ION × 13 MANGANESE (II) ION × 2 water × 4	Consistent with all polymers
2	Protein–DNA	Homooligomer	Protein 2 DNA 2	DNA (28-MER) × 1 DNA (28-MER) × 1 SULFATE ION × 10 MANGANESE (II) ION × 3 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HSF4_HALSA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–111； UniProt 6–116 Author chain B； PDBConstruct 1–111； UniProt 6–116 Author chain C； PDBConstruct 1–111； UniProt 6–116 Author chain D； PDBConstruct 1–111； UniProt 6–116

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qh0
Deposition date deposition_date	2019-01-14
Structure title title	The complex structure of hsRosR-S5 (VNG0258H/RosR-S5)
Keywords keywords	Halophiles, wHTH DNA binding protein, RosR, High salt medium, DNA BINDING PROTEIN, Protein-DNA interactions; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qh0__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qh0__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qh0__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.78 Å
Rg (electron density)	24.24 Å
Total Rg	25.02 Å
Atom count	5363
Residues	280
Excluded volume	48927 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qh0__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6qh0__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	hsRosR DNA binding protein
Molecular weight formula_weight	13179.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	10940

PDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRRERVETIVADDAAALE

Source Source

Source organism organism	Halobacterium salinarum NRC-1
NCBI taxonomy ID ncbi_taxonomy_id	64091
Host organism host_organism	Haloferax volcanii

Entity 2 Entity 2 polymer

Description description	DNA (28-MER)
Molecular weight formula_weight	8678.6 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E,G

AAGTCATGTAAGAGGGATGACACTTCGC

Entity 3 Entity 3 polymer

Description description	DNA (28-MER)
Molecular weight formula_weight	8531.5 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F,H

GCGAAGTGTCATCCCTCTTACATGACTT

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	23

Entity 5 Entity 5 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	91

▶

Unit-cell length a length_a	46.545 Å
Unit-cell length b length_b	83.109 Å
Unit-cell length c length_c	89.601 Å
Unit-cell angle α angle_alpha	95.81 °
Unit-cell angle β angle_beta	95.50 °
Unit-cell angle γ angle_gamma	105.11 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.436 Å
Low-resolution limit resolution_low	44.569 Å
R factor r_factor	0.2407
R_work r_work	0.2392
R_free r_free	0.2676

The complex structure of hsRosR-S5 (VNG0258H/RosR-S5)

1. Protein Identity and Related Structures Protein Identity & Related Structures

hsRosR DNA binding protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qh0__assembly_2__model_1

6qh0__assembly_2__model_1 | I(q)

6qh0__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

The complex structure of hsRosR-S5 (VNG0258H/RosR-S5)

1. Protein Identity and Related Structures Protein Identity & Related Structures

hsRosR DNA binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qh0__assembly_2__model_1

6qh0__assembly_2__model_1 | I(q)

6qh0__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)