SAXSdb — 6qj4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Condensin complex subunit 1,Condensin complex subunit 1,Condensin complex subunit 1

Chaetomium thermophilum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Condensin complex subunit 2 × 1 （G0SBJ6） Uncharacterized protein,Uncharacterized protein × 1 （G0S2G2） Brn1 × 1 Condensin complex subunit 2 × 1 （G0SBJ6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SB82_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–1098； UniProt 3–1219

Condensin complex subunit 2

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0SBJ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Condensin complex subunit 1,Condensin complex subunit 1,Condensin complex subunit 1 × 1 （G0SB82） Uncharacterized protein,Uncharacterized protein × 1 （G0S2G2） Brn1 × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SBJ6_CHATD
Isoform	—
PDB entities	2, 5
Chains and sequence ranges	Author chain B； PDBConstruct 4–197； UniProt 225–418 Author chain E； PDBConstruct 1–135； UniProt 764–898

Uncharacterized protein,Uncharacterized protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S2G2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Condensin complex subunit 1,Condensin complex subunit 1,Condensin complex subunit 1 × 1 （G0SB82） Condensin complex subunit 2 × 1 （G0SBJ6） Brn1 × 1 Condensin complex subunit 2 × 1 （G0SBJ6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S2G2_CHATD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 3–206； UniProt 263–466 Author chain C； PDBConstruct 213–389； UniProt 1366–1542

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qj4
Deposition date deposition_date	2019-01-22
Structure title title	Crystal structure of the C. thermophilum condensin Ycs4-Brn1 subcomplex bound to the Smc4 ATPase head in complex with the C-terminal domain of Brn1
Keywords keywords	condensin, SMC complex, ATPase, chromosome condensation, loop extrusion, CELL CYCLE; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qj4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qj4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qj4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.84 Å
Rg (electron density)	48.95 Å
Total Rg	48.91 Å
Atom count	10778
Residues	1412
Excluded volume	192490 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qj4__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Condensin complex subunit 1,Condensin complex subunit 1,Condensin complex subunit 1
Molecular weight formula_weight	128880.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	10778

MTVNWDINEALKNYMSDPSTIQTPEADSALVDCENDPESLLDNGLINSVLNPIVDAVAESPDAITRSHIFDSLQFLLKYTSYLSTHALSKLFDLITSGLGAEADVVHHDLESDEQELIPAHKQLLEMYGFLLQWTLTAAEAKAAEKSSTTVPARGRGKPKSKTGPGQDGTWDSVRQLETALSTMCKVLRLKLGKIFITTSERDTFIGLLTRPVYMILESEQRVKNTSIRMHAFKVLCMAVKHHGHGYAAQVSIVQNLTYFEHLSEPMAEFLHILAEQYDYPQLADEVLRELSNKEFNSNDTKGPKSVSAFMIRLSELAPRLVIKQVTLLAKQLDSESYTLRCALIEVFGNMLAYLSKSEERGENHKSQMNAFFDVLEERFLDINPYCRCRTIQVYIKLCELDQKFPKRRQRAAELACRSLMDKSSHVRRNAIKLLATLIRTHPFTALHGAQLARKDWQERLERVEAELNVLKPPPEAAGLEGDKANTSADQGLLDDATQVDSPKKRLEDMTEEEKIEAVRKAQEQAATSEAIEKLTLTKRYYTEALKFIDVLHEATPVICQLLGSKNKSEVIEAMDYFEIGDAYNIEQNKIGIRKMLRLIWTKGSSDEGKGVQTHLIECYKRLFFEAPDSFSPNDAANYIARNMISLTFGATPAELTSLEQLLHLMMKQGMIPDLVIAKLWQVYGVQRREISKKQRRGAIIVLGMLATASPEIVVGEMETMLRIGLGAHGRADLQLAKYTCIALRRINPTSRQTEKGSTTTFSRLPNDHAVLVKLAAITEVPTDNKEWYGVAEQAINAIYALSKHPDVLCSEIIRRKTRAVFARSTSKESVIGLSQLLFIVGHVAIKQIVHLELCELDFKRRKQEKDKEKAQQQEQEDNELDMIGGTTEDDFTEAMAHIRERELLFGPQSLLAQFGPMVSEICANNTVYKDRNLQQAATLCLAKLMCVSSEYCEANLPLLITIMERSPDPTVRSNAVIALGDMAVCFNHLIDENTDFLYRRLADPQPMVKRTCLMTLTFLILAGQVKVKGQLGEMAKCLEDEDKRIADLARMFFTELSTKDNAVYNHFVDMFSLLSADERIDEEAFRRIVRFLLGFVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Condensin complex subunit 2
Molecular weight formula_weight	21545.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GHMEDGTVRKKPKKKTQRSSEATLAPSFASLQLKKLELEFAVDPFFKKASADFDEGGAKGLLLNHLMIDSQGRIVFDSSDDAEDVAEASAKPSREADDERPDSEDADADGDISMTDRDASAPGQVETQPEEEDEDVEIDVAALGAKYFPDLSILDSLDVCPSLKTFDLGDPSGSLYIPFLKVPDDWRHDQEKEKTPG

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Uncharacterized protein,Uncharacterized protein
Molecular weight formula_weight	44726.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAPPVEDTGPKPRIVITHLVLTNFKSYAGRQEVGPFHPSFTSVVGPNGSGKSNVIDSLLFVFGFRASKMRQGKISALIHNSAQYPNLDYCEVAVHFHEVLDLPGGGHEVVPNSELVISRKAFKNNSSSYFINGKPSNFTTVTTLLRERGVDLDHKRFLILQGEVESIAQMKPKAANEHEDGLLEYLEDIIGTSKYKGPIEEAAAEVSGGSGGSTAVAQRDAAKKRCDELRRMRLEGFMEGFSTISLRLKEMYQMITMGGNAELELVDSLDPFSEGILFSVMPPKKSWKNISNLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVANYIKERTRNAQFIVISLRNNMFELASRLVGVYKVNHMTKSVTIDNKDYVIGRAGISSASHHHHHHHH

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Brn1
Molecular weight formula_weight	1975.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

XXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Condensin complex subunit 2
Molecular weight formula_weight	15511.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MRPEYVQYARVAKKVDVRRLKEEIWKGMGFDELTSSNSNDTSQLQTPARQAEEQRSPESADGPNGKDKDPTLRFTDVMNSLQRVYPKQVMDDISTSYCFICLLHLANEKGLVIEKTDTLDELYIRKDWSAVVGDE

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Spodoptera frugiperda

▶

Unit-cell length a length_a	84.405 Å
Unit-cell length b length_b	82.378 Å
Unit-cell length c length_c	177.834 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.77 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	5.800 Å
Low-resolution limit resolution_low	47.743 Å
R factor r_factor	0.2926
R_work r_work	0.2919
R_free r_free	0.3015

Crystal structure of the C. thermophilum condensin Ycs4-Brn1 subcomplex bound to the Smc4 ATPase head in complex with the C-terminal domain of Brn1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Condensin complex subunit 1,Condensin complex subunit 1,Condensin complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Condensin complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein,Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qj4__assembly_1__model_1

6qj4__assembly_1__model_1 | I(q)

6qj4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of the C. thermophilum condensin Ycs4-Brn1 subcomplex bound to the Smc4 ATPase head in complex with the C-terminal domain of Brn1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Condensin complex subunit 1,Condensin complex subunit 1,Condensin complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Condensin complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein,Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qj4__assembly_1__model_1

6qj4__assembly_1__model_1 | I(q)

6qj4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)