SAXSdb — 6qzi

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin-7

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 33–279	Not recorded	GOL GLYCEROL × 56 PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；85 mM Tris pH 8.0, 37 % v/v PEG 200 and 0.80 % v/v OG	Resolution 1.90 Å R-free 0.195

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6QZI	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6KXW Crystal structure of human aquaporin AQP7 in bound to glycerol Deposited 2019-09-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–342（342 aa） Chain B 1–342（342 aa） Chain C 1–342（342 aa） Chain D 1–342（342 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；277 K；30% v/v PEG 400, 50mM CAPS, pH 10.0, 0.16% w/v 1,5-Naphthalenedisulfonic acid disodium, 0.16% w/v Naphthalene-1,3,6-trisulfonic acid trisodium, 0.16% 1,4-piperazinediethanesulfonic acid	Resolution 3.70 Å R-free 0.322
6N1G Crystal structure of Aquaglyceroporin AQP7 Deposited 2018-11-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–342（342 aa） Chain C 1–342（342 aa）	Not recorded	GOL GLYCEROL × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；30% w/v polyethylene glycol 400, 100 mM MOPS pH 7.0, 100 mM NaCl.	Resolution 4.00 Å R-free 0.277
6N1G Crystal structure of Aquaglyceroporin AQP7 Deposited 2018-11-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 1–342（342 aa） Chain D 1–342（342 aa）	Not recorded	GOL GLYCEROL × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；30% w/v polyethylene glycol 400, 100 mM MOPS pH 7.0, 100 mM NaCl.	Resolution 4.00 Å R-free 0.277
6QZJ Crystal structure of human Aquaporin 7 at 2.2 A resolution Deposited 2019-03-11	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–279（247 aa）	Not recorded	GOL GLYCEROL × 44 PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；85 mM Tris pH 8.0, 37 % v/v PEG 200 and 0.80 % v/v OG	Resolution 2.20 Å R-free 0.243
8AMW AQP7 dimer of tetramers_C1 Deposited 2022-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–342（342 aa） Chain B 1–342（342 aa） Chain C 1–342（342 aa） Chain D 1–342（342 aa） Chain E 1–342（342 aa） Chain F 1–342（342 aa） Chain G 1–342（342 aa） Chain H 1–342（342 aa）	Not recorded	GOL GLYCEROL × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 3s wait, 0s drain time, 0 blot force	Resolution 3.00 Å
8AMX AQP7 dimer of tetramers_D4 Deposited 2022-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–342（342 aa） Chain B 1–342（342 aa） Chain C 1–342（342 aa） Chain D 1–342（342 aa） Chain E 1–342（342 aa） Chain F 1–342（342 aa） Chain G 1–342（342 aa） Chain H 1–342（342 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 3s wait, 0s drain time, 0 blot force	Resolution 2.55 Å
8C9H AQP7_inhibitor Deposited 2023-01-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–342（342 aa） Chain B 1–342（342 aa） Chain C 1–342（342 aa） Chain D 1–342（342 aa） Chain E 1–342（342 aa） Chain F 1–342（342 aa） Chain G 1–342（342 aa） Chain H 1–342（342 aa）	Not recorded	T60 ethyl 4-[(4-pyrazol-1-ylphenyl)methylcarbamoylamino]benzoate × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3s blot, 3s wait, 0s drain time, 0 blot force	Resolution 3.20 Å
8Y8V Cryo-EM structure of AQP7 in POPC nanodisc Deposited 2024-02-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–342（342 aa）	Not recorded	P5S O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
8Y8V Cryo-EM structure of AQP7 in POPC nanodisc Deposited 2024-02-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–342（342 aa）	Not recorded	P5S O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
8Y8V Cryo-EM structure of AQP7 in POPC nanodisc Deposited 2024-02-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–342（342 aa）	Not recorded	P5S O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å

7 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AQP7_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–247； UniProt 33–279

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qzi
Deposition date deposition_date	2019-03-11
Structure title title	Crystal structure of human Aquaporin 7 at 1.9 A resolution
Keywords keywords	Aquaglyceroporin, glycerol channel, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.88 Å
Radius of gyration Rg (electron density) rg_electron	17.85 Å
Forward intensity I(0) i0	12605900.00
Molecular weight molecular_weight	28218.0 kDa
Excluded volume excluded_volume	36002 Å³
Envelope volume envelope_volume	39630 Å³
Hydration-shell volume shell_volume	18418 Å³
Envelope diameter envelope_diameter	64.6 Å
Shell Rg shell_rg	24.26 Å
Envelope Rg envelope_rg	18.37 Å
Shape Rg shape_rg	17.82 Å
Total Rg total_rg	18.97 Å
Total atoms total_atoms	1982
Residues n_residues	247
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	63.3 Å
Rg (real space) rg_real	18.85 Å
Rg uncertainty (real space) rg_real_error	0.39 Å
I(0) (real space) i0_real	1.2610e+07
I(0) uncertainty (real space) i0_real_error	1.6710e+05
Rg (reciprocal space) rg_reciprocal	18.85 Å
I(0) (reciprocal space) i0_reciprocal	12610000.0000
Solution quality estimate total_estimate	0.7989
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.9 Å
Skewness Skewness skewness	0.353
Kurtosis Kurtosis kurtosis	-0.192
Angular range angular_range	— – 0.4200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2370000.0000
Real-space data points n_real_points	73
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.797; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.992; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Aquaporin-7
Molecular weight formula_weight	26766.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2046

MVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGST

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Komagataella pastoris

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	39

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	6qziA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

▶

8. Citations (1)

▶

Unit-cell length a length_a	85.831 Å
Unit-cell length b length_b	85.831 Å
Unit-cell length c length_c	83.051 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	I 4
Space-group number int_tables_number	79
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	41.525 Å
R factor r_factor	0.1730
R_work r_work	0.1720
R_free r_free	0.1945

fit	/app/data/saxs_computation/qz/6qzi/6qzi.fit
pddf	/app/data/pr_computation/qz/6qzi/6qzi.pr.out
profile	/app/data/saxs_computation/qz/6qzi/6qzi.dat

Crystal structure of human Aquaporin 7 at 1.9 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin-7

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction