SAXSdb — 6rwx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein MxiG

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Lipoprotein MxiJ × 24 （Q06081）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MXIG_SHIFL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–371； UniProt 1–371 Author chain B； PDBConstruct 1–371； UniProt 1–371 Author chain C； PDBConstruct 1–371； UniProt 1–371 Author chain D； PDBConstruct 1–371； UniProt 1–371 Author chain E； PDBConstruct 1–371； UniProt 1–371 Author chain F； PDBConstruct 1–371； UniProt 1–371 Author chain G； PDBConstruct 1–371； UniProt 1–371 Author chain H； PDBConstruct 1–371； UniProt 1–371 Author chain I； PDBConstruct 1–371； UniProt 1–371 Author chain J； PDBConstruct 1–371； UniProt 1–371 Author chain K； PDBConstruct 1–371； UniProt 1–371 Author chain L； PDBConstruct 1–371； UniProt 1–371 Author chain M； PDBConstruct 1–371； UniProt 1–371 Author chain N； PDBConstruct 1–371； UniProt 1–371 Author chain O； PDBConstruct 1–371； UniProt 1–371 Author chain P； PDBConstruct 1–371； UniProt 1–371 Author chain Q； PDBConstruct 1–371； UniProt 1–371 Author chain R； PDBConstruct 1–371； UniProt 1–371 Author chain S； PDBConstruct 1–371； UniProt 1–371 Author chain T； PDBConstruct 1–371； UniProt 1–371 Author chain U； PDBConstruct 1–371； UniProt 1–371 Author chain V； PDBConstruct 1–371； UniProt 1–371 Author chain W； PDBConstruct 1–371； UniProt 1–371 Author chain X； PDBConstruct 1–371； UniProt 1–371

Lipoprotein MxiJ

OrganismNot specified

UniProt Q06081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Protein MxiG × 24 （P0A221）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MXIJ_SHIFL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–241； UniProt 1–241 Author chain b； PDBConstruct 1–241； UniProt 1–241 Author chain c； PDBConstruct 1–241； UniProt 1–241 Author chain d； PDBConstruct 1–241； UniProt 1–241 Author chain e； PDBConstruct 1–241； UniProt 1–241 Author chain f； PDBConstruct 1–241； UniProt 1–241 Author chain g； PDBConstruct 1–241； UniProt 1–241 Author chain h； PDBConstruct 1–241； UniProt 1–241 Author chain i； PDBConstruct 1–241； UniProt 1–241 Author chain j； PDBConstruct 1–241； UniProt 1–241 Author chain k； PDBConstruct 1–241； UniProt 1–241 Author chain l； PDBConstruct 1–241； UniProt 1–241 Author chain m； PDBConstruct 1–241； UniProt 1–241 Author chain n； PDBConstruct 1–241； UniProt 1–241 Author chain o； PDBConstruct 1–241； UniProt 1–241 Author chain p； PDBConstruct 1–241； UniProt 1–241 Author chain q； PDBConstruct 1–241； UniProt 1–241 Author chain r； PDBConstruct 1–241； UniProt 1–241 Author chain s； PDBConstruct 1–241； UniProt 1–241 Author chain t； PDBConstruct 1–241； UniProt 1–241 Author chain u； PDBConstruct 1–241； UniProt 1–241 Author chain v； PDBConstruct 1–241； UniProt 1–241 Author chain w； PDBConstruct 1–241； UniProt 1–241 Author chain x； PDBConstruct 1–241； UniProt 1–241

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6rwx
Deposition date deposition_date	2019-06-06
Structure title title	Periplasmic inner membrane ring of the Shigella type 3 secretion system
Keywords keywords	type 3 secretion system, shigella, ring-forming membrane protein, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6rwx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6rwx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6rwx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	86.45 Å
Rg (electron density)	86.33 Å
Total Rg	86.29 Å
Atom count	70968
Residues	8784
Excluded volume	1270700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6rwx__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Protein MxiG
Molecular weight formula_weight	43053.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,R,Q,P,O,N,M,L,K,J,I,H,G,F,E,D,C,B,A,W,V,U,X
Atom count atom_count	70968

MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNGMYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQNDAVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSKERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNKVTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLNDKHWFFLDKNK

Entity 2 Entity 2 polymer

Description description	Lipoprotein MxiJ
Molecular weight formula_weight	27542.1 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x

MIRYKGFILFLLLMLIGCEQREELISNLSQRQANEIISVLERHNITARKVDGGKQGISVQVEKGTFASAVDLMRMYDLPNPERVDISQMFPTDSLVSSPRAEKARLYSAIEQRLEQSLVSIGGVISAKIHVSYDLEEKNISSKPMHISVIAIYDSPKESELLVSNIKRFLKNTFSDVKYENISVILTPKEEYVYTNVQPVKEVKSEFLTNEVIYLFLGMAVLVVILLVWAFKTGWFKRNKI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.55 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	72298

Periplasmic inner membrane ring of the Shigella type 3 secretion system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein MxiG

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein MxiJ

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6rwx__assembly_1__model_1

6rwx__assembly_1__model_1 | I(q)

6rwx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Periplasmic inner membrane ring of the Shigella type 3 secretion system

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein MxiG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lipoprotein MxiJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6rwx__assembly_1__model_1

6rwx__assembly_1__model_1 | I(q)

6rwx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)