SAXSdb — 6scf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Uncharacterized protein

Sulfolobus islandicus rod-shaped virus 1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 2 RNA 1	cyclic oligoadenylate × 1 water × 3	Consistent with all polymers
2	Protein–RNA	Homooligomer	Protein 2 RNA 1	cyclic oligoadenylate × 1 water × 3	Consistent with all polymers
3	Protein–RNA	Homooligomer	Protein 2 RNA 1	cyclic oligoadenylate × 1 water × 3	Consistent with all polymers
4	Protein–RNA	Homooligomer	Protein 2 RNA 1	cyclic oligoadenylate × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y114_SIRV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–138； UniProt 1–114 Author chain B； PDBConstruct 25–138； UniProt 1–114 Author chain C； PDBConstruct 25–138； UniProt 1–114 Author chain D； PDBConstruct 25–138； UniProt 1–114 Author chain E； PDBConstruct 25–138； UniProt 1–114 Author chain F； PDBConstruct 25–138； UniProt 1–114 Author chain G； PDBConstruct 25–138； UniProt 1–114 Author chain H； PDBConstruct 25–138； UniProt 1–114

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6scf
Deposition date deposition_date	2019-07-24
Structure title title	A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
Keywords keywords	CRISPR cyclic oligoadenylate DNA anti-CRISPR viral, DNA; DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6scf__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6scf__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6scf__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.25 Å
Rg (electron density)	17.20 Å
Total Rg	18.17 Å
Atom count	1885
Residues	228
Excluded volume	33824 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6scf__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6scf__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6scf__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6scf__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	16207.5 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	8312

MSYYHHHHHHDYDIPTTENLYFQGMNKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD

Source Source

Source organism organism	Sulfolobus islandicus rod-shaped virus 1
NCBI taxonomy ID ncbi_taxonomy_id	157898
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	cyclic oligoadenylate
Molecular weight formula_weight	1271.9 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	K,I,L,M

AAAA

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	592

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6scfA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfG00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

Domain ID domain_id	6scfH00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11170 — Uncharacterised protein PF08960, DUF1874

▶

Unit-cell length a length_a	49.829 Å
Unit-cell length b length_b	51.727 Å
Unit-cell length c length_c	85.611 Å
Unit-cell angle α angle_alpha	80.22 °
Unit-cell angle β angle_beta	89.68 °
Unit-cell angle γ angle_gamma	83.38 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.550 Å
Low-resolution limit resolution_low	50.640 Å
R factor r_factor	0.2039
R_work r_work	0.2015
R_free r_free	0.2490

A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6scf__assembly_3__model_1

6scf__assembly_3__model_1 | I(q)

6scf__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6scf__assembly_3__model_1

6scf__assembly_3__model_1 | I(q)

6scf__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)