SAXSdb — 6uzc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Portal protein × 12 （P13334）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSH_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–521； UniProt 1–521 Author chain B； PDBConstruct 1–521； UniProt 1–521 Author chain C； PDBConstruct 1–521； UniProt 1–521 Author chain D； PDBConstruct 1–521； UniProt 1–521 Author chain a； PDBConstruct 1–521； UniProt 1–521 Author chain b； PDBConstruct 1–521； UniProt 1–521 Author chain c； PDBConstruct 1–521； UniProt 1–521 Author chain d； PDBConstruct 1–521； UniProt 1–521 Author chain e； PDBConstruct 1–521； UniProt 1–521 Author chain f； PDBConstruct 1–521； UniProt 1–521 Author chain g； PDBConstruct 1–521； UniProt 1–521 Author chain h； PDBConstruct 1–521； UniProt 1–521 Author chain i； PDBConstruct 1–521； UniProt 1–521 Author chain j； PDBConstruct 1–521； UniProt 1–521 Author chain k； PDBConstruct 1–521； UniProt 1–521 Author chain l； PDBConstruct 1–521； UniProt 1–521 Author chain m； PDBConstruct 1–521； UniProt 1–521 Author chain n； PDBConstruct 1–521； UniProt 1–521 Author chain o； PDBConstruct 1–521； UniProt 1–521 Author chain p； PDBConstruct 1–521； UniProt 1–521 Author chain q； PDBConstruct 1–521； UniProt 1–521 Author chain r； PDBConstruct 1–521； UniProt 1–521 Author chain s； PDBConstruct 1–521； UniProt 1–521 Author chain t； PDBConstruct 1–521； UniProt 1–521 Author chain u； PDBConstruct 1–521； UniProt 1–521 Author chain v； PDBConstruct 1–521； UniProt 1–521 Author chain w； PDBConstruct 1–521； UniProt 1–521 Author chain x； PDBConstruct 1–521； UniProt 1–521 Author chain y； PDBConstruct 1–521； UniProt 1–521 Author chain z； PDBConstruct 1–521； UniProt 1–521

Portal protein

OrganismNot specified

UniProt P13334

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Major capsid protein × 30 （P04535）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PORTL_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–524； UniProt 1–524 Author chain F； PDBConstruct 1–524； UniProt 1–524 Author chain G； PDBConstruct 1–524； UniProt 1–524 Author chain H； PDBConstruct 1–524； UniProt 1–524 Author chain I； PDBConstruct 1–524； UniProt 1–524 Author chain J； PDBConstruct 1–524； UniProt 1–524 Author chain K； PDBConstruct 1–524； UniProt 1–524 Author chain L； PDBConstruct 1–524； UniProt 1–524 Author chain M； PDBConstruct 1–524； UniProt 1–524 Author chain N； PDBConstruct 1–524； UniProt 1–524 Author chain O； PDBConstruct 1–524； UniProt 1–524 Author chain P； PDBConstruct 1–524； UniProt 1–524

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6uzc
Deposition date deposition_date	2019-11-14
Structure title title	Portal vertex structure of bacteriophage T4
Keywords keywords	portal protein assembly, gp20, gp23, portal vertex, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6uzc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6uzc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6uzc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	108.10 Å
Total Rg	108.10 Å
Atom count	150312
Residues	19473
Excluded volume	2669900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6uzc__assembly_1__model_1`	42-meric （42）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Major capsid protein
Molecular weight formula_weight	56074.2 kDa
Source method src_method	nat
Copy count entity_count	30

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z,A,B,C,D
Atom count atom_count	150312

MTIKTKAELLNKWKPLLEGEGLPEIANSKQAIIAKIFENQEKDFQTAPEYKDEKIAQAFGSFLTEAEIGGDHGYNATNIAAGQTSGAVTQIGPAVMGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPVAAGAKEAFHPMYGPDAMFSGQGAAKKFPALAASTQTTVGDIYTHFFQETGTVYLQASVQVTIDAGATDAAKLDAEIKKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTLTPGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIASRNVVNVLASVDTGISYAAQGLATGFSTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGPNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGINPFAESAAQAPASRIQSGMPSILNSLGKNAYFRRVYVKGI

Entity 2 Entity 2 polymer

Description description	Portal protein
Molecular weight formula_weight	61117.1 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H,I,J,K,L,M,N,O,P

MKFNVLSLFAPWAKMDERNFKDQEKEDLVSITAPKLDDGAREFEVSSNEAASPYNAAFQTIFGSYEPGMKTTRELIDTYRNLMNNYEVDNAVSEIVSDAIVYEDDTEVVALNLDKSKFSPKIKNMMLDEFSDVLNHLSFQRKGSDHFRRWYVDSRIFFHKIIDPKRPKEGIKELRRLDPRQVQYVREIITETEAGTKIVKGYKEYFIYDTAHESYACDGRMYEAGTKIKIPKAAVVYAHSGLVDCCGKNIIGYLHRAVKPANQLKLLEDAVVIYRITRAPDRRVWYVDTGNMPARKAAEHMQHVMNTMKNRVVYDASTGKIKNQQHNMSMTEDYWLQRRDGKAVTEVDTLPGADNTGNMEDIRWFRQALYMALRVPLSRIPQDQQGGVMFDSGTSITRDELTFAKFIRELQHKFEEVFLDPLKTNLLLKGIITEDEWNDEINNIKIEFHRDSYFAELKEAEILERRINMLTMAEPFIGKYISHRTAMKDILQMTDEEIEQEAKQIEEESKEARFQDPDQEQEDF

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	53608

Portal vertex structure of bacteriophage T4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6uzc__assembly_1__model_1

6uzc__assembly_1__model_1 | I(q)

6uzc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Portal vertex structure of bacteriophage T4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6uzc__assembly_1__model_1

6uzc__assembly_1__model_1 | I(q)

6uzc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)