6ve7

The inner junction complex of Chlamydomonas reinhardtii doublet microtubule

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar associated protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	FAP52 × 2 （A0A2K3D260） Tubulin alpha × 24 （P09204） Protein Flattop homolog × 1 （A8IVJ1） Tubulin beta × 24 （P04690） FAP276 × 2 （A0A2K3DTN6） Cilia- and flagella-associated protein 20 × 4 （A8IU92） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J098_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–240； UniProt 1–240

FAP52

OrganismNot specified

UniProt A0A2K3D260

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） Tubulin alpha × 24 （P09204） Protein Flattop homolog × 1 （A8IVJ1） Tubulin beta × 24 （P04690） FAP276 × 2 （A0A2K3DTN6） Cilia- and flagella-associated protein 20 × 4 （A8IU92） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D260_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–633； UniProt 1–633 Author chain C； PDBConstruct 1–633； UniProt 1–633

Tubulin alpha

OrganismNot specified

UniProt P09204

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） FAP52 × 2 （A0A2K3D260） Protein Flattop homolog × 1 （A8IVJ1） Tubulin beta × 24 （P04690） FAP276 × 2 （A0A2K3DTN6） Cilia- and flagella-associated protein 20 × 4 （A8IU92） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 0； PDBConstruct 1–451； UniProt 1–451 Author chain 1； PDBConstruct 1–451； UniProt 1–451 Author chain 5； PDBConstruct 1–451； UniProt 1–451 Author chain 6； PDBConstruct 1–451； UniProt 1–451 Author chain 7； PDBConstruct 1–451； UniProt 1–451 Author chain D； PDBConstruct 1–451； UniProt 1–451 Author chain E； PDBConstruct 1–451； UniProt 1–451 Author chain F； PDBConstruct 1–451； UniProt 1–451 Author chain G； PDBConstruct 1–451； UniProt 1–451 Author chain L； PDBConstruct 1–451； UniProt 1–451 Author chain M； PDBConstruct 1–451； UniProt 1–451 Author chain P； PDBConstruct 1–451； UniProt 1–451 Author chain S； PDBConstruct 1–451； UniProt 1–451 Author chain X； PDBConstruct 1–451； UniProt 1–451 Author chain Y； PDBConstruct 1–451； UniProt 1–451 Author chain Z； PDBConstruct 1–451； UniProt 1–451 Author chain e； PDBConstruct 1–451； UniProt 1–451 Author chain f； PDBConstruct 1–451； UniProt 1–451 Author chain h； PDBConstruct 1–451； UniProt 1–451 Author chain k； PDBConstruct 1–451； UniProt 1–451 Author chain m； PDBConstruct 1–451； UniProt 1–451 Author chain o； PDBConstruct 1–451； UniProt 1–451 Author chain s； PDBConstruct 1–451； UniProt 1–451 Author chain y； PDBConstruct 1–451； UniProt 1–451

Protein Flattop homolog

OrganismNot specified

UniProt A8IVJ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） FAP52 × 2 （A0A2K3D260） Tubulin alpha × 24 （P09204） Tubulin beta × 24 （P04690） FAP276 × 2 （A0A2K3DTN6） Cilia- and flagella-associated protein 20 × 4 （A8IU92） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–137； UniProt 1–137

Tubulin beta

OrganismNot specified

UniProt P04690

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） FAP52 × 2 （A0A2K3D260） Tubulin alpha × 24 （P09204） Protein Flattop homolog × 1 （A8IVJ1） FAP276 × 2 （A0A2K3DTN6） Cilia- and flagella-associated protein 20 × 4 （A8IU92） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 1–443； UniProt 1–443 Author chain 8； PDBConstruct 1–443； UniProt 1–443 Author chain 9； PDBConstruct 1–443； UniProt 1–443 Author chain I； PDBConstruct 1–443； UniProt 1–443 Author chain J； PDBConstruct 1–443； UniProt 1–443 Author chain K； PDBConstruct 1–443； UniProt 1–443 Author chain N； PDBConstruct 1–443； UniProt 1–443 Author chain O； PDBConstruct 1–443； UniProt 1–443 Author chain Q； PDBConstruct 1–443； UniProt 1–443 Author chain R； PDBConstruct 1–443； UniProt 1–443 Author chain T； PDBConstruct 1–443； UniProt 1–443 Author chain U； PDBConstruct 1–443； UniProt 1–443 Author chain V； PDBConstruct 1–443； UniProt 1–443 Author chain a； PDBConstruct 1–443； UniProt 1–443 Author chain b； PDBConstruct 1–443； UniProt 1–443 Author chain i； PDBConstruct 1–443； UniProt 1–443 Author chain j； PDBConstruct 1–443； UniProt 1–443 Author chain p； PDBConstruct 1–443； UniProt 1–443 Author chain q； PDBConstruct 1–443； UniProt 1–443 Author chain r； PDBConstruct 1–443； UniProt 1–443 Author chain t； PDBConstruct 1–443； UniProt 1–443 Author chain u； PDBConstruct 1–443； UniProt 1–443 Author chain v； PDBConstruct 1–443； UniProt 1–443 Author chain w； PDBConstruct 1–443； UniProt 1–443

FAP276

OrganismNot specified

UniProt A0A2K3DTN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） FAP52 × 2 （A0A2K3D260） Tubulin alpha × 24 （P09204） Protein Flattop homolog × 1 （A8IVJ1） Tubulin beta × 24 （P04690） Cilia- and flagella-associated protein 20 × 4 （A8IU92） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DTN6_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain W； PDBConstruct 1–86； UniProt 1–86 Author chain x； PDBConstruct 1–86； UniProt 1–86

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt A8IU92

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） FAP52 × 2 （A0A2K3D260） Tubulin alpha × 24 （P09204） Protein Flattop homolog × 1 （A8IVJ1） Tubulin beta × 24 （P04690） FAP276 × 2 （A0A2K3DTN6） PACRG × 4 （B1B601） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 3； PDBConstruct 1–190； UniProt 1–190 Author chain c； PDBConstruct 1–190； UniProt 1–190 Author chain g； PDBConstruct 1–190； UniProt 1–190 Author chain z； PDBConstruct 1–190； UniProt 1–190

PACRG

OrganismNot specified

UniProt B1B601

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 62	Flagellar associated protein × 1 （A8J098） FAP52 × 2 （A0A2K3D260） Tubulin alpha × 24 （P09204） Protein Flattop homolog × 1 （A8IVJ1） Tubulin beta × 24 （P04690） FAP276 × 2 （A0A2K3DTN6） Cilia- and flagella-associated protein 20 × 4 （A8IU92） GUANOSINE-5'-TRIPHOSPHATE × 24 MAGNESIUM ION × 24 GUANOSINE-5'-DIPHOSPHATE × 24 TAXOL × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B1B601_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 2； PDBConstruct 1–307； UniProt 1–307 Author chain d； PDBConstruct 1–307； UniProt 1–307 Author chain l； PDBConstruct 1–307； UniProt 1–307 Author chain n； PDBConstruct 1–307； UniProt 1–307

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ve7
Deposition date deposition_date	2019-12-30
Structure title title	The inner junction complex of Chlamydomonas reinhardtii doublet microtubule
Keywords keywords	cilia, doublet, axoneme, microtubule inner protein, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ve7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ve7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ve7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	120.00 Å
Total Rg	119.90 Å
Atom count	192224
Residues	24285
Excluded volume	3403400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ve7__assembly_1__model_1`	62-meric （62）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Flagellar associated protein
Molecular weight formula_weight	27019.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	192224

MQEESVYALIPQPQEVPQRPAMHTSKFGGKTHPAQFDFGQNKVQPHATMGRPDGANGPAFLHAHEKEPKLPSPGPPSNPKQKIRPPVPAKEEKPTMGLTSNKNFITANAVDVILAKPGKVPQPEFQWTQKPDYGKVPMYLKRNKDRVAKEKEHFTQYLRMREAPEANAHVSQLSPEDRQQLVRHLKAKWGSVNTAYQGLSLSVDSAVKKGRKEAMERELAEIERDIRTLERGEVVLVVDD

Entity 2 Entity 2 polymer

Description description	FAP52
Molecular weight formula_weight	68546.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MAEPLVLNSVIGFGGAIENGLIAHPDGRTIIYPLGSTIVLRDRADPRSQEFLQGHSDKVSCLALSRSGRYLASGQITYMGFTADIIIWDLESKQLIHRMALHKVKVQALDFSCDERFLASLGGQDDNALVLWDVASGNAICGSPCNTNFTNCVKFFNNSPDKLITAGNFNMNVWTYDAGNNKLRPTDATLGTLKRVFKSVVVDANDEYAYCGTTTGDVLQIALERVLFKNTGPAKGNVQMGVTATCEVPTGDILVGGGDGSLQVLRTVPEPSSTNPKLLRKMPALAGTKVEGAITSIALADMNARGFTFFVGTAMCNIYKVTYEPATSRLKEELVQTAHNDKINGMAFPNEYSEVFATCGTGFIRLWHLTTCRELLRIAVPNLECFCIAFTTDGSAILSGWSDGKIRAFGPQSGKIIFTINDAHQKAVTAIASTADSSRILSGGEEGMVRVWRIGRTSQTLEASMKDHKGPVNCIRIKGSGDECVSASSDGSCILWDLHTFKRRTSLFANTFFKSVVYHPDESQLVTAGTDRKVTYWDAYDGNAIRIIDGSDLDEVNALAVDRDGEALVSGGGDKLVKLWGYDEGHCYFVGVAHSGAITAVGVTPDKQRIVSVGTEGGIFIWDYQRPQTLADI

Entity 3 Entity 3 polymer

Description description	Tubulin alpha
Molecular weight formula_weight	49638.0 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F,G,L,M,P,S,X,Y,Z,e,f,h,k,m,o,s,y,0,1,5,6,7

MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDFEEVGAESAEGAGEGEGEEY

Entity 4 Entity 4 polymer

Description description	Protein Flattop homolog
Molecular weight formula_weight	15435.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSRSYPGEQVEHAFNSKRLKNWEVPAVDKSQAISTSTGTRFGTLQPRSGRTQFIVDDNGHLKSGVPKLEKSAFNFTQTTPVFMDSAPRWPKENPTWPKNMKATMGYKGIQSNYLPTNTVTLKAVEVPGTTERNFNFM

Entity 5 Entity 5 polymer

Description description	Tubulin beta
Molecular weight formula_weight	49665.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,N,O,Q,R,T,U,V,a,b,i,j,p,q,r,t,u,v,w,4,8,9

MREIVHIQGGQCGNQIGAKFWEVVSDEHGIDPTGTYHGDSDLQLERINVYFNEATGGRYVPRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAESCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVVPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPTFGDLNHLISAVMSGITCCLRFPGQLNADLRKLAVNLIPFPRLHFFMVGFTPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPKGLKMSATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASAEEEGEFEGEEEEA

Entity 6 Entity 6 polymer

Description description	FAP276
Molecular weight formula_weight	9986.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,x

MDLKQQVKNYTMTIRNTRPPTMIKEQDKSEFSHFRALQVLANGDEVPYEATLRNVIHDGARQPKLPPRQTQKHPGYIRNESGGFFT

Entity 7 Entity 7 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22193.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,g,z,3

MFKNAFQSGFLSVLYSIGSKPLEIWDKQVSNGHIKRITDADIQSSVLEIMGQNVSTTYITCPADPNKTLGIKLPFLVLIIKNLNKYFSFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDSGWNQIQFNLSDFTRRAYGTNYIETLRVQVHANCRIRRIYFSDRLYSEEELPAEFKLFLPIQKS

Entity 8 Entity 8 polymer

Description description	PACRG
Molecular weight formula_weight	34215.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,l,n,2

MNGDVAGSLFTSTYRNVKLAGKAPPAANLSGTGSCFDTTSLSPARAGAHKALDVQKDELPVWSKSTLSYKYPAGRPNPTGFLKKGDGEMIKTKTGGFEERKPSPPQAGAYKRRENPPNTAFRRFYERGDLPIAVDHRGSKNMIAWKVDIEKLDYHHYLPIFFDGIRETQEPYRFLAVKGVEDMLRVGGSKILPVIPQLIIPIKTALNTRDHSVMCITLQLLQKLVLSADLVGEALVPYYRQILPIFNLYKNKNKNLGDGIDYGQRNYDCLGELIADTLALFEQKGGDDAFINIKYMVPTYESSVNYA

Entity 9 Entity 9 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 10 Entity 10 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 11 Entity 11 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 12 Entity 12 non-polymer

Description description	TAXOL
Molecular weight formula_weight	853.9 kDa
Source method src_method	syn
Copy count entity_count	16

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	270713

The inner junction complex of Chlamydomonas reinhardtii doublet microtubule

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FAP52

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein Flattop homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

FAP276

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PACRG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ve7__assembly_1__model_1

6ve7__assembly_1__model_1 | I(q)

6ve7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer