6xbw

Cryo-EM structure of V-ATPase from bovine brain, state 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase catalytic subunit A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATA_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–617； UniProt 1–617 Author chain B； PDBConstruct 1–617； UniProt 1–617 Author chain C； PDBConstruct 1–617； UniProt 1–617

V-type proton ATPase subunit B, brain isoform

OrganismNot specified

UniProt P31408

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATB2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–511； UniProt 1–511 Author chain E； PDBConstruct 1–511； UniProt 1–511 Author chain F； PDBConstruct 1–511； UniProt 1–511

V-type proton ATPase subunit C 1

OrganismNot specified

UniProt P21282

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATC1_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–382； UniProt 1–382

V-type proton ATPase subunit D

OrganismNot specified

UniProt A0A3Q1M4W9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Q1M4W9_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–247； UniProt 1–247

V-type proton ATPase subunit E 1

OrganismNot specified

UniProt P11019

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATE1_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–226； UniProt 1–226 Author chain J； PDBConstruct 1–226； UniProt 1–226 Author chain K； PDBConstruct 1–226； UniProt 1–226

V-type proton ATPase subunit F

OrganismNot specified

UniProt Q28029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATF_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–119； UniProt 1–119

V-type proton ATPase subunit G

OrganismNot specified

UniProt Q0VCV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q0VCV6_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain M； PDBConstruct 1–118； UniProt 1–118 Author chain N； PDBConstruct 1–118； UniProt 1–118 Author chain O； PDBConstruct 1–118； UniProt 1–118

V-type proton ATPase subunit H

OrganismNot specified

UniProt F1MZL6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1MZL6_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain P； PDBConstruct 1–465； UniProt 1–465

V-type proton ATPase subunit a

OrganismNot specified

UniProt F1MJV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1MJV0_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain a； PDBConstruct 1–838； UniProt 1–838

V-type proton ATPase 21 kDa proteolipid subunit

OrganismNot specified

UniProt Q2TA24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATO_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain b； PDBConstruct 1–205； UniProt 1–205

V-type proton ATPase subunit d 1

OrganismNot specified

UniProt P61420

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0D1_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain d； PDBConstruct 1–351； UniProt 1–351

V-type proton ATPase subunit e 2

OrganismNot specified

UniProt Q2KIB5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VA0E2_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain e； PDBConstruct 1–81； UniProt 1–81

V-type proton ATPase subunit S1

OrganismNot specified

UniProt P40682

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VAS1_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain s； PDBConstruct 1–468； UniProt 1–468

Renin receptor

OrganismNot specified

UniProt P81134

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RENR_BOVIN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain r； PDBConstruct 1–351； UniProt 1–351

V-type proton ATPase 16 kDa proteolipid subunit

OrganismNot specified

UniProt P23956

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） Ribonuclease kappa × 1 （Q3ZC23） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATL_BOVIN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain c； PDBConstruct 1–155； UniProt 1–155 Author chain g； PDBConstruct 1–155； UniProt 1–155 Author chain k； PDBConstruct 1–155； UniProt 1–155 Author chain l； PDBConstruct 1–155； UniProt 1–155 Author chain m； PDBConstruct 1–155； UniProt 1–155 Author chain n； PDBConstruct 1–155； UniProt 1–155 Author chain o； PDBConstruct 1–155； UniProt 1–155 Author chain p； PDBConstruct 1–155； UniProt 1–155 Author chain q； PDBConstruct 1–155； UniProt 1–155

Ribonuclease kappa

OrganismNot specified

UniProt Q3ZC23

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 32	V-type proton ATPase catalytic subunit A × 3 （P31404） V-type proton ATPase subunit B, brain isoform × 3 （P31408） V-type proton ATPase subunit C 1 × 1 （P21282） V-type proton ATPase subunit D × 1 （A0A3Q1M4W9） V-type proton ATPase subunit E 1 × 3 （P11019） V-type proton ATPase subunit F × 1 （Q28029） V-type proton ATPase subunit G × 3 （Q0VCV6） V-type proton ATPase subunit H × 1 （F1MZL6） V-type proton ATPase subunit a × 1 （F1MJV0） V-type proton ATPase 21 kDa proteolipid subunit × 1 （Q2TA24） V-type proton ATPase subunit d 1 × 1 （P61420） V-type proton ATPase subunit e 2 × 1 （Q2KIB5） V-type proton ATPase subunit S1 × 1 （P40682） Renin receptor × 1 （P81134） V-type proton ATPase 16 kDa proteolipid subunit × 9 （P23956） MAGNESIUM ION × 1 ADENOSINE-5'-DIPHOSPHATE × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 9 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 OLEIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RNK_BOVIN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain f； PDBConstruct 1–98； UniProt 1–98

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6xbw
Deposition date deposition_date	2020-06-07
Structure title title	Cryo-EM structure of V-ATPase from bovine brain, state 1
Keywords keywords	PROTON TRANSPORT; PROTON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6xbw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6xbw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6xbw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	80.94 Å
Rg (electron density)	81.87 Å
Total Rg	81.81 Å
Atom count	63090
Residues	8186
Excluded volume	1134700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6xbw__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	V-type proton ATPase catalytic subunit A
Molecular weight formula_weight	68420.9 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	63090

MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDVKWDFTPCKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGIKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKADYAQLLEDMQNAFRSLED

Entity 2 Entity 2 polymer

Description description	V-type proton ATPase subunit B, brain isoform
Molecular weight formula_weight	56637.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MALRAMRGIVNGAAPELPVPTSGPLAGSREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVYETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH

Entity 3 Entity 3 polymer

Description description	V-type proton ATPase subunit C 1
Molecular weight formula_weight	44042.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Entity 4 Entity 4 polymer

Description description	V-type proton ATPase subunit D
Molecular weight formula_weight	28297.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSDKDLEQRRAAGEVIEPANLLAEEKDEDLLFE

Entity 5 Entity 5 polymer

Description description	V-type proton ATPase subunit E 1
Molecular weight formula_weight	26178.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K

MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPVYKVATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

Entity 6 Entity 6 polymer

Description description	V-type proton ATPase subunit F
Molecular weight formula_weight	13417.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Entity 7 Entity 7 polymer

Description description	V-type proton ATPase subunit G
Molecular weight formula_weight	13588.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O

MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVDQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIAA

Entity 8 Entity 8 polymer

Description description	V-type proton ATPase subunit H
Molecular weight formula_weight	54155.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISSEDCEFIQRFEMKRSPEEKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTLVDDTLQENHQRVSIFFDYAKRSKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSVWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSVERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS

Entity 9 Entity 9 polymer

Description description	V-type proton ATPase subunit a
Molecular weight formula_weight	96431.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDLGHGILMTLFAVWMVLRESRILSQKNENEMFSTIFSGRYIILLMGVFSIYTGLIYNDCFSKSLNIFGSSWSVRPMFDIYNWTEETLRGNPVLQLNPAVTGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHTYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYNAKTSEKAPSLLIHFINMFLFSYGDSGNSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLKVKSLAGGLALFFIFAAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFDD

Entity 10 Entity 10 polymer

Description description	V-type proton ATPase 21 kDa proteolipid subunit
Molecular weight formula_weight	21530.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGLVLLYSGVFVAFWACLLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD

Entity 11 Entity 11 polymer

Description description	V-type proton ATPase subunit d 1
Molecular weight formula_weight	40369.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Entity 12 Entity 12 polymer

Description description	V-type proton ATPase subunit e 2
Molecular weight formula_weight	9189.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MTAHSFALPVVIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE

Entity 13 Entity 13 polymer

Description description	V-type proton ATPase subunit S1
Molecular weight formula_weight	51818.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MMAATAAAQVRAGTRWAPALCRMPWLPLMLVAAAAATSEQQVPLVLWSSDRGLWAPAADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLQELKLNASIPALLLIRLPYTASSGLMAPKEVLMGNDEVIGQVLSTLKSEDIPYTAALTAVRPSRVARDVAMVTGGLGRQLLQRTVVPPTMNVPVSYNDSYDTRILFWAQNFSVAYGEHWEDLTSRTFGVQDLNLTGSFWNDTVARLVLTYDSLFGTMVTFKFILANSYYSVSARHWFTLENLEIHSNGSVAYFNASQVTGPSIYSFHCEHVSSENEDGNLLVPDTQPSLWQMTFRDFQIQAFNVTDKKFSYASDCAGFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTITLTQIV

Entity 14 Entity 14 polymer

Description description	Renin receptor
Molecular weight formula_weight	39529.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAVLVVFLSFLVADVFGNEFSILRSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVDKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLTSLPLNSLSRNNEVDLLFLSELQVLRDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKHYGEDSEQFRDASKILIDALQKFADDMYNLYGGNAVVELVTVRSFDTSLVRKTRNILETKQVKDPSTTYNLAYKYNFEYPVVFNLVLWIMIGLALTLIVTCYNIWNMDPGYDSIIYRMTNQKIRMD

Entity 15 Entity 15 polymer

Description description	V-type proton ATPase 16 kDa proteolipid subunit
Molecular weight formula_weight	15727.7 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,g,k,l,m,n,o,p,q

MSEAKNGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Entity 16 Entity 16 polymer

Description description	Ribonuclease kappa
Molecular weight formula_weight	11030.0 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAASLYLLLGGFSFCQVRLNKRKEYMVR

Entity 17 Entity 17 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
Molecular weight formula_weight	760.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 20 Entity 20 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 21 Entity 21 non-polymer

Description description	OLEIC ACID
Molecular weight formula_weight	282.5 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6xbwH01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3240 —

Domain ID domain_id	6xbwI01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2320 — hypothetical protein PF0899 fold
Homologous superfamily homologous superfamily	30 — ATP synthase, E subunit, C-terminal

Domain ID domain_id	6xbwJ01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2320 — hypothetical protein PF0899 fold
Homologous superfamily homologous superfamily	30 — ATP synthase, E subunit, C-terminal

Domain ID domain_id	6xbwK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2320 — hypothetical protein PF0899 fold
Homologous superfamily homologous superfamily	30 — ATP synthase, E subunit, C-terminal

▶

Resolution resolution	3.37 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	84345

Cryo-EM structure of V-ATPase from bovine brain, state 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

V-type proton ATPase catalytic subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit B, brain isoform

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit C 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit E 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase subunit a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

V-type proton ATPase 21 kDa proteolipid subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer