6ycx

Plasmodium falciparum Myosin A full-length, pre-powerstroke state

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin-A

Plasmodium falciparum (isolate 3D7)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Myosin A tail domain interacting protein × 2 （W7K1J7） Uncharacterized protein × 1 （A0A2I0BQX1） Uncharacterized protein × 1 （A0A2I0BQX1） ADENOSINE-5'-DIPHOSPHATE × 2 VANADATE ION × 2 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MYOA_PLAF7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–818； UniProt 1–818 Author chain B； PDBConstruct 1–818； UniProt 1–818

Myosin A tail domain interacting protein

Plasmodium falciparum (isolate NF54)

UniProt W7K1J7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Myosin-A × 2 （Q8IDR3） Uncharacterized protein × 1 （A0A2I0BQX1） Uncharacterized protein × 1 （A0A2I0BQX1） ADENOSINE-5'-DIPHOSPHATE × 2 VANADATE ION × 2 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W7K1J7_PLAFO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–204； UniProt 1–204 Author chain H； PDBConstruct 1–204； UniProt 1–204

Uncharacterized protein

Plasmodium falciparum (isolate NF54)

UniProt A0A2I0BQX1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Myosin-A × 2 （Q8IDR3） Myosin A tail domain interacting protein × 2 （W7K1J7） ADENOSINE-5'-DIPHOSPHATE × 2 VANADATE ION × 2 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I0BQX1_PLAFO
Isoform	—
PDB entities	3, 4
Chains and sequence ranges	Author chain F； PDBConstruct 1–134； UniProt 1–134 Author chain G； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ycx
Deposition date deposition_date	2020-03-19
Structure title title	Plasmodium falciparum Myosin A full-length, pre-powerstroke state
Keywords keywords	Myosin A, Myosin, Plasmodium, Myosin XIV, Myosin 14, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ycx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ycx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ycx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.29 Å
Rg (electron density)	52.57 Å
Total Rg	52.52 Å
Atom count	17259
Residues	2153
Excluded volume	308850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ycx__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Myosin-A
Molecular weight formula_weight	92474.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	17452

MAVTNEEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQQGSKKEKLTVVQIDPPGTGTPYDIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDFLKHRYLKNQIYTTAVPLIVAINPYKDLGNTTNEWIRRYRDTADHTKLPPHVFTCAREALSNLHGVNKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLRIQTAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLVISHEGGIRYGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGANSTMKSKFGLKGVTEYKLLNPNSTEVSGVDDVKDFEEVIESLKNMELSESDIEVIFSIVAGILTLGNVRLIEKQEAGLSDAAAIMDEDMGVFNKACELMYLDPELIKREILIKVTVAGGTKIEGRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPEGGFKTFMGMLDIFGFEVFKNNSLEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAELKYTSNKEVINVLCEKGKSVLSYLEDQCLAPGGTDEKFVSSCATNLKENNKFTPAKVASNKNFIIQHTIGPIQYCAESFLLKNKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSLIGSQFLNQLTSLMNLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKFVDIAAAEDSSVENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKILTKIQREKLVEWENCVSVIEAAILKHKYKQKVNKNIPSLLRVQAHIRKKMVAQ

Source Source

Source organism organism	Plasmodium falciparum (isolate 3D7)
NCBI taxonomy ID ncbi_taxonomy_id	36329
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Myosin A tail domain interacting protein
Molecular weight formula_weight	23510.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MKQECNVCYFNLPDPESTLGPYDNELNYFTWGPGFEYEPEPQRKPLSIEESFENSEESEESVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCEDILQ

Source Source

Source organism organism	Plasmodium falciparum (isolate NF54)
NCBI taxonomy ID ncbi_taxonomy_id	5843
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	15706.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MASDMEEKFREAFILFSSCSDHIEMYKFFELMNSFGIILTNDEKAALPNDINMDYWLNFAKKHYNYEQPFKHINNVNEQNTNVQIKIDNFLGIMKALDTRLTESDLNILLQITNPENKTTLNLKTVSQKLTESI

Source Source

Source organism organism	Plasmodium falciparum (isolate NF54)
NCBI taxonomy ID ncbi_taxonomy_id	5843
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	15692.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MASDMEEKFREAFILFSSCSDHIEMYKFFELMNSFGIILTNDEKAALPNDINMDYWLNFAKKHYNYEQPFKHINNVNEQNTNVQIKIDNFLGIMKALDTRLTESDLNILLQITNPENKSTLNLKTVSQKLTESI

Source Source

Source organism organism	Plasmodium falciparum (isolate NF54)
NCBI taxonomy ID ncbi_taxonomy_id	5843
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	VANADATE ION
Molecular weight formula_weight	114.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	168.240 Å
Unit-cell length b length_b	287.430 Å
Unit-cell length c length_c	78.610 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	3.990 Å
Low-resolution limit resolution_low	48.400 Å
R factor r_factor	0.2390
R_work r_work	0.2370
R_free r_free	0.2730

Plasmodium falciparum Myosin A full-length, pre-powerstroke state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin-A

State in the Current Structure

Other States of the Same Protein in the Database

Myosin A tail domain interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ycx__assembly_1__model_1

6ycx__assembly_1__model_1 | I(q)

6ycx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)

Plasmodium falciparum Myosin A full-length, pre-powerstroke state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Myosin A tail domain interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ycx__assembly_1__model_1

6ycx__assembly_1__model_1 | I(q)

6ycx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)