Palmitoleoyl-protein carboxylesterase NOTUM
Homo sapiens
State in the Current Structure
| Assembly | Oligomeric State | Construct | Mutations and Modifications | Ligands, Ions and Associated Components | Method and Experimental Conditions | Structure Quality |
|---|---|---|---|---|---|---|
| 1 | Protein monomer Monomer Protein × 1 PDB declaration: monomeric(1) Consistent with protein copy count | Chain A; UniProt 81–451 | Mutation:C330S | SO4 SULFATE ION × 16 DMS DIMETHYL SULFOXIDE × 1 PQH 2-methyl-5-(trifluoromethyl)-1~{H}-pyrrole-3-carboxylic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 | X-RAY DIFFRACTION X-ray crystallization conditions:VAPOR DIFFUSION, SITTING DROP;pH 4;295 K;1.4 M AMMONIUM SULPHATE, 0.1 M CITRIC ACID, PH 4.0 | Resolution 2.00 Å R-free 0.231 |
Other States of the Same Protein in the Database
Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.
| Other PDB | Difference from Current Entry 6YUY | Assembly / Oligomeric State | Construct | Mutations and Modifications | Ligands, Ions and Non-polymers | Method and Experimental Conditions | Structure Quality |
|---|---|---|---|---|---|---|---|
| 4UYU STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I IODIDE COMPLEX - 2.3A Deposited 2014-09-03 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 IOD IODIDE ION × 5 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 7.5;20 %W/V PEG 3350 0.1 M BT PROPANE PH 6.5 0.2 M NAI
|
Resolution 2.30 Å R-free 0.243 |
| 4UYU STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I IODIDE COMPLEX - 2.3A Deposited 2014-09-03 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
81–451(371 aa)
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 IOD IODIDE ION × 6 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 7.5;20 %W/V PEG 3350 0.1 M BT PROPANE PH 6.5 0.2 M NAI
|
Resolution 2.30 Å R-free 0.243 |
| 4UYW STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I HEPARIN FRAGMENT COMPLEX - 1.7A Deposited 2014-09-03 | Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Other combination Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 8;pH 8.0
|
Resolution 1.70 Å R-free 0.221 |
| 4UYW STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I HEPARIN FRAGMENT COMPLEX - 1.7A Deposited 2014-09-03 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
81–451(371 aa)
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 8;pH 8.0
|
Resolution 1.70 Å R-free 0.221 |
| 4UYZ STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM II - 2.8A Deposited 2014-09-03 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
38–496(459 aa)
Fragment:RESIDUES 38-496
|
Not recorded | No recorded non-water small molecule |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6;pH 6.0
|
Resolution 2.80 Å R-free 0.293 |
| 4UYZ STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM II - 2.8A Deposited 2014-09-03 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
38–496(459 aa)
Fragment:RESIDUES 38-496
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6;pH 6.0
|
Resolution 2.80 Å R-free 0.293 |
| 4UYZ STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM II - 2.8A Deposited 2014-09-03 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 3 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain C
38–496(459 aa)
Fragment:RESIDUES 38-496
|
Not recorded | No recorded non-water small molecule |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6;pH 6.0
|
Resolution 2.80 Å R-free 0.293 |
| 4UYZ STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM II - 2.8A Deposited 2014-09-03 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 4 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain D
38–496(459 aa)
Fragment:RESIDUES 38-496
|
Not recorded | No recorded non-water small molecule |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6;pH 6.0
|
Resolution 2.80 Å R-free 0.293 |
| 4UZ1 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM III - 1.4A Deposited 2014-09-04 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
80–452(373 aa)
Fragment:RESIDUES 80-452
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 4.6;1.5 M AMMONIUM SULPHATE, 0.1 M SODIUM ACETATE PH 4.6
|
Resolution 1.40 Å R-free 0.180 |
| 4UZ5 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM IV - 2.1A Deposited 2014-09-04 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
80–452(373 aa)
Fragment:RESIDUES 80-452
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6;10 %W/V PEG4000, 0.01 M CACL2, 0.05 M NACACOD PH 6.0, 0.20 M KCL, 1 MM HEPARIN HEXAMER
|
Resolution 2.10 Å R-free 0.237 |
| 4UZ6 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM V - SOS COMPLEX - 1.9A Deposited 2014-09-04 | Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Other combination Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
Fragment:RESIDUES 81-451
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 7.5;20 %W/V PEG3350, 0.2 M AMMONIUM SULFATE 20MM SOS, pH 7.5
|
Resolution 1.90 Å R-free 0.235 |
| 4UZ6 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM V - SOS COMPLEX - 1.9A Deposited 2014-09-04 | Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Other combination Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
81–451(371 aa)
Fragment:RESIDUES 81-451
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 7.5;20 %W/V PEG3350, 0.2 M AMMONIUM SULFATE 20MM SOS, pH 7.5
|
Resolution 1.90 Å R-free 0.235 |
| 4UZ7 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM VI - 2.2A Deposited 2014-09-04 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
Fragment:UNP RESIDUES 81-451
|
Mutation:YES | CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 8.5;20 %V/V GLYCEROL 24 %W/V PEG4000 0.160 M MGCL2 0.080 M TRIS-HCL PH 8.5 20MM SOS
|
Resolution 2.20 Å R-free 0.229 |
| 4UZ7 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM VI - 2.2A Deposited 2014-09-04 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
81–451(371 aa)
Fragment:UNP RESIDUES 81-451
|
Mutation:YES | No recorded non-water small molecule |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 8.5;20 %V/V GLYCEROL 24 %W/V PEG4000 0.160 M MGCL2 0.080 M TRIS-HCL PH 8.5 20MM SOS
|
Resolution 2.20 Å R-free 0.229 |
| 4UZ9 STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM VII - SOS COMPLEX - 2.2A Deposited 2014-09-04 | Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Other combination Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
Fragment:RESIDUES 81-451
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6.5;200 MM AMMONIUM SULFATE 100 MM MES 6.5 35 % W/V PEP 629 20MM SOS
|
Resolution 2.20 Å R-free 0.237 |
| 4UZA STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM VIII - PHOSPHATE COMPLEX - 2.4A Deposited 2014-09-04 | Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein homooligomer Homooligomer;Protein × 3 PDB declaration: trimeric |
Chain A
80–452(373 aa)
Fragment:RESIDUES 80-452
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PO4 PHOSPHATE ION × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 6.3;0.630 M K2HPO4 1.170 M NAH2PO4 6.300 PH FINAL PH
|
Resolution 2.40 Å R-free 0.271 |
| 4UZL STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I MYRISTOLEATE COMPLEX - 2.1A Deposited 2014-09-05 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
Fragment:RESIDUES 81-451
|
Mutation:YES | MYZ Myristoleic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 5;10 %W/V POLYETHYLENE GLYCOL 6000, 0.1 M CITRATE PH 5.0
|
Resolution 2.10 Å R-free 0.253 |
| 4UZL STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I MYRISTOLEATE COMPLEX - 2.1A Deposited 2014-09-05 | Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
81–451(371 aa)
Fragment:RESIDUES 81-451
|
Mutation:YES | MYZ Myristoleic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 5;10 %W/V POLYETHYLENE GLYCOL 6000, 0.1 M CITRATE PH 5.0
|
Resolution 2.10 Å R-free 0.253 |
| 4UZQ STRUCTURE OF THE WNT DEACYLASE NOTUM IN COMPLEX WITH O-PALMITOLEOYL SERINE - CRYSTAL FORM IX - 1.5A Deposited 2014-09-07 | Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein heterocomplex Heteromer;Protein × 4 PDB declaration: tetrameric |
Chain A
81–451(371 aa)
Fragment:RESIDUES 81-451
|
Mutation:YES | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NA SODIUM ION × 4 CL CHLORIDE ION × 6 PAM PALMITOLEIC ACID × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
pH 5;3.0M NACL, 0.1 M CITRATE PH 5.0
|
Resolution 1.50 Å R-free 0.178 |
| 4WBH STRUCTURE OF THE WNT DEACYLASE NOTUM - CRYSTAL FORM I APO - 2.2A Deposited 2014-09-03 | Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein homooligomer Homooligomer;Protein × 2 PDB declaration: dimeric |
Chain A
38–496(459 aa)
Fragment:UNP residues 38-496
Chain B
38–496(459 aa)
Fragment:UNP residues 38-496
|
Not recorded | CL CHLORIDE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION;pH 6;293 K;30% PEG3350,
100mM BisTris 6.0,
5% Glycerol,
200mM Ammonium Sulfate
|
Resolution 2.20 Å R-free 0.262 |
| 6R8P Notum fragment 723 Deposited 2019-04-02 | Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 12 DMS DIMETHYL SULFOXIDE × 1 JVB 2-(2-methylphenoxy)-~{N}-pyridin-3-yl-ethanamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5M Ammonium sulfate
0.1 M Sodium citrate
pH4.2
|
Resolution 1.45 Å R-free 0.227 |
| 6R8Q STRUCTURE OF THE WNT DEACYLASE NOTUM IN COMPLEX WITH A BENZOTRIAZOLE FRAGMENT Deposited 2019-04-02 | Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 8 EDO 1,2-ETHANEDIOL × 5 JV5 ~{N}-(1~{H}-benzotriazol-5-yl)-2-(2-methylphenoxy)ethanamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;295 K;1.4 M AMMONIUM SULPHATE,
0.1 M CITRIC ACID,
PH 4.0
|
Resolution 1.50 Å R-free 0.195 |
| 6R8R Structure of the Wnt deacylase Notum in complex with isoquinoline 45 Deposited 2019-04-02 | Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JV8 ~{N}-isoquinolin-6-yl-2-(2-methylphenoxy)ethanamide × 1 SO4 SULFATE ION × 8 DMS DIMETHYL SULFOXIDE × 5 EDO 1,2-ETHANEDIOL × 10 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;300 K;1.4 M ammonium sulphate, 0.1 M citric acid, pH 4
|
Resolution 1.27 Å R-free 0.178 |
| 6T2H Furano[2,3-d]prymidine amides as Notum inhibitors Deposited 2019-10-08 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | DMS DIMETHYL SULFOXIDE × 2 SO4 SULFATE ION × 7 EDO 1,2-ETHANEDIOL × 13 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 M9N 2-[[(4~{S})-5-chloranyl-6-methyl-1,2,3,4-tetrahydrothieno[2,3-d]pyrimidin-4-yl]sulfanyl]ethanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;300 K;1.5M Ammonium sulfate 0.1 M Sodium citrate pH4.2
|
Resolution 1.41 Å R-free 0.198 |
| 6T2K Furano[2,3-d]prymidine amides as Notum inhibitors Deposited 2019-10-08 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 M9K 2-(6-chloranyl-7-cyclopropyl-thieno[3,2-d]pyrimidin-4-yl)sulfanylethanoic acid × 1 EDO 1,2-ETHANEDIOL × 4 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5M Ammonium sulfate 0.1 M Sodium citrate pH4.2
|
Resolution 1.38 Å R-free 0.214 |
| 6TR5 Melatonin-Notum complex Deposited 2019-12-17 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | ML1 N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide × 2 DMS DIMETHYL SULFOXIDE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 8 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5 M ammonium sulphate
0.1 M sodium citrate pH 4.2
|
Resolution 1.51 Å R-free 0.226 |
| 6TR6 N-acetylserotonin-Notum complex Deposited 2019-12-17 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 EDO 1,2-ETHANEDIOL × 2 DMS DIMETHYL SULFOXIDE × 4 ASE N-ACETYL SEROTONIN × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5 M ammonium sulphate
0.1 M sodium citrate pH 4.2.
|
Resolution 1.35 Å R-free 0.193 |
| 6TR7 N-[2-(5-fluoro-1H-indol-3-yl)ethyl]acetamide-Notum complex Deposited 2019-12-17 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 EDO 1,2-ETHANEDIOL × 12 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 HWH ~{N}-[2-(5-fluoranyl-1~{H}-indol-3-yl)ethyl]ethanamide × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5 M ammonium sulphate
0.1 M sodium citrate pH 4.2
|
Resolution 1.47 Å R-free 0.220 |
| 6TUZ Theophylline-Notum complex Deposited 2020-01-08 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 4 EDO 1,2-ETHANEDIOL × 20 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 TEP THEOPHYLLINE × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5 M Ammonium sulphate
0.1 M sodium citrate pH4.2
|
Resolution 1.24 Å R-free 0.217 |
| 6TV4 CFF-Notum complex Deposited 2020-01-08 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 12 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 CFF CAFFEINE × 1 GOL GLYCEROL × 5 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;300 K;1.5 M Ammonium Sulphate
0.1 M Sodium citrate pH 4.2
|
Resolution 1.53 Å R-free 0.214 |
| 6YSK 1-phenylpyrroles and 1-enylpyrrolidines as inhibitors of Notum Deposited 2020-04-22 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 8 PJK (3~{S})-1-[4-chloranyl-3-(trifluoromethyl)phenyl]pyrrolidine-3-carboxylic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;300 K;1.5 M Ammonium sulphate
0.1 M Sodium citrate, pH4.2
|
Resolution 1.21 Å R-free 0.210 |
| 6YUW STRUCTURE OF THE WNT DEACYLASE NOTUM IN COMPLEX WITH A PYRROLE-3-CARBOXYLIC ACID FRAGMENT 454 Deposited 2020-04-27 | Different ligand/ion Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | SO4 SULFATE ION × 2 PQZ 1-(cyclopropylmethyl)-2,5-dimethyl-pyrrole-3-carboxylic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;295 K;1.4 M AMMONIUM SULPHATE, 0.1 M CITRIC ACID, PH 4.0
|
Resolution 1.94 Å R-free 0.227 |
| 6YV0 STRUCTURE OF THE WNT DEACYLASE NOTUM IN COMPLEX WITH A PYRROLIDINE-3-CARBOXYLIC ACID FRAGMENT 587 Deposited 2020-04-27 | Different ligand/ion Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 4 PQT (3~{R})-1-(2-chlorophenyl)pyrrolidine-3-carboxylic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;295 K;1.4 M AMMONIUM SULPHATE, 0.1 M CITRIC ACID, PH 4.0
|
Resolution 2.00 Å R-free 0.234 |
| 6YV2 STRUCTURE OF THE WNT DEACYLASE NOTUM IN COMPLEX WITH A PYRROLIDINE-3-CARBOXYLIC ACID FRAGMENT 598 Deposited 2020-04-27 | Different ligand/ion Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PUE (3~{R})-1-phenylpyrrolidine-3-carboxylic acid × 1 SO4 SULFATE ION × 3 EDO 1,2-ETHANEDIOL × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;295 K;1.4 M AMMONIUM SULPHATE, 0.1 M CITRIC ACID, PH 4.0
|
Resolution 2.10 Å R-free 0.226 |
| 6YV4 STRUCTURE OF THE WNT DEACYLASE NOTUM IN COMPLEX WITH A PYRROLE-3-CARBOXYLIC ACID FRAGMENT 686 Deposited 2020-04-27 | Different ligand/ion Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | PQK 1-cyclopropyl-2,5-dimethyl-pyrrole-3-carboxylic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 2 EDO 1,2-ETHANEDIOL × 5 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;295 K;1.4 M AMMONIUM SULPHATE, 0.1 M CITRIC ACID, PH 4.0
|
Resolution 2.00 Å R-free 0.233 |
| 6YXI Structure of Notum in complex with a 1-(3-Chlorophenyl)-2,5-dimethyl-1H-pyrrole-3-carboxylic acid inhibitor Deposited 2020-05-01 | Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Mutation:C330S | PZ8 1-(3-chlorophenyl)-2,5-dimethyl-pyrrole-3-carboxylic acid × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 SO4 SULFATE ION × 7 EDO 1,2-ETHANEDIOL × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4;300 K;1.4 M ammonium sulphate, 0.1 M citric acid, pH 4
|
Resolution 1.34 Å R-free 0.185 |
| 6ZUV Notum fragment 286 Deposited 2020-07-23 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 6 EDO 1,2-ETHANEDIOL × 3 B1J [1-(4-chlorophenyl)-1,2,3-triazol-4-yl]methanol × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;293 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.54 Å R-free 0.259 |
| 6ZVL ARUK3000263 complex with Notum Deposited 2020-07-24 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 2 EDO 1,2-ETHANEDIOL × 1 QR2 5-[4-chloranyl-3-(trifluoromethyl)phenyl]-3~{H}-1,3,4-oxadiazol-2-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;293 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH 4.2
|
Resolution 1.30 Å R-free 0.223 |
| 6ZYF Notum_Ghrelin complex Deposited 2020-07-31 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 K4Q [(2~{S})-2-azanyl-3-oxidanylidene-propyl] octanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 7;296 K;0.1 M Hepes pH 7.0
0.1 M KCl
15% PEG MME 5000
|
Resolution 2.19 Å R-free 0.252 |
| 6ZYF Notum_Ghrelin complex Deposited 2020-07-31 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 2 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain B
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 K4Q [(2~{S})-2-azanyl-3-oxidanylidene-propyl] octanoate × 1 EDO 1,2-ETHANEDIOL × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 7;296 K;0.1 M Hepes pH 7.0
0.1 M KCl
15% PEG MME 5000
|
Resolution 2.19 Å R-free 0.252 |
| 7ARG Notum in complex with ARUK3002704 Deposited 2020-10-24 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 6 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 5 RW8 methyl 4-(2,3-dihydroindol-1-yl)-4-oxidanylidene-butanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citric, pH4.6
|
Resolution 1.24 Å R-free 0.198 |
| 7B2V Notum complex with ARUK3003906 Deposited 2020-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 6 DMS DIMETHYL SULFOXIDE × 1 SRH ethyl 4-(2,3-dihydroindol-1-yl)-4-oxidanylidene-butanoate × 1 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.24 Å R-free 0.199 |
| 7B2Y Notum complex with ARUK3003910 Deposited 2020-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 1 SRQ 2,2-bis(fluoranyl)ethyl 4-(2,3-dihydroindol-1-yl)-4-oxidanylidene-butanoate × 1 EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.23 Å R-free 0.208 |
| 7B2Z Notum complex with ARUK3003907 Deposited 2020-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 4 SQW propan-2-yl 4-indol-1-yl-4-oxidanylidene-butanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.24 Å R-free 0.209 |
| 7B37 Notum complex with ARUK3003718 Deposited 2020-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 2 SRK 4-(2,3-dihydroindol-1-yl)-4-oxidanylidene-butanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.34 Å R-free 0.203 |
| 7B3F Notum S232A in complex with ARUK3003718 Deposited 2020-11-30 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 2 SRK 4-(2,3-dihydroindol-1-yl)-4-oxidanylidene-butanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.39 Å R-free 0.216 |
| 7B3G Notum complex with ARUK3003902 Deposited 2020-11-30 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 2 SSQ 6-((2-chlorophenyl)thio)-[1,2,4]triazolo[4,3-b]pyridazin-3(2H)-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.28 Å R-free 0.215 |
| 7B3H Notum complex with ARUK3003909 Deposited 2020-11-30 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 EDO 1,2-ETHANEDIOL × 3 SSW 6-((3-(trifluoromethoxy)phenyl)thio)-[1,2,4]triazolo[4,3-b]pyridazin-3(2H)-one × 1 DMS DIMETHYL SULFOXIDE × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.28 Å R-free 0.204 |
| 7B3I Notum complex with ARUK3003776 Deposited 2020-12-01 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 3 STK 3-(3-chlorophenyl)sulfanyl-1$l^{4},2,7,8-tetrazabicyclo[4.3.0]nona-1(6),2,4,7-tetraen-9-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.34 Å R-free 0.197 |
| 7B3P Notum complex with ARUK3003775 Deposited 2020-12-01 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 DMS DIMETHYL SULFOXIDE × 2 EDO 1,2-ETHANEDIOL × 2 SUQ 6-((4-chlorophenyl)thio)-[1,2,4]triazolo[4,3-b]pyridazin-3(2H)-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.28 Å R-free 0.199 |
| 7B3X Notum complex with ARUK3003748 Deposited 2020-12-01 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 DMS DIMETHYL SULFOXIDE × 1 SUT 6-(m-tolylthio)-[1,2,4]triazolo[4,3-b]pyridazin-3(2H)-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.34 Å R-free 0.203 |
| 7B45 Notum complex with ARUK3003934 Deposited 2020-12-02 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 1 SWQ 6-(3-methylsulfanylphenyl)sulfanyl-2~{H}-[1,2,4]triazolo[4,3-b]pyridazin-3-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.38 Å R-free 0.194 |
| 7B4X Notum complex with ARUK3002697 Deposited 2020-12-02 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 4 SWT 6-(4-methylphenyl)sulfanyl-2~{H}-[1,2,4]triazolo[4,3-b]pyridazin-3-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.24 Å R-free 0.219 |
| 7B50 Notum complex with ARUK3003778 Deposited 2020-12-03 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 3 SXQ 3-(3,4-dichlorophenyl)sulfanyl-1$l^{4},2,7,8-tetrazabicyclo[4.3.0]nona-1(6),2,4,7-tetraen-9-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.33 Å R-free 0.205 |
| 7B7W Notum-Fragment049 Deposited 2020-12-11 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 3 JGA N-ethyl-N'-(5-methyl-1,2-oxazol-3-yl)urea × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate
|
Resolution 1.60 Å R-free 0.227 |
| 7B7X Notum-Fragment063 Deposited 2020-12-11 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 5 WKA N-(2,1,3-benzoxadiazol-4-yl)acetamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 2.41 Å R-free 0.245 |
| 7B7Y Notum-Fragment064 Deposited 2020-12-11 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 6 JFP N-(4-methyl-1,3-thiazol-2-yl)propanamide × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.48 Å R-free 0.238 |
| 7B84 Notum-Fragment065 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 6 JFS [4-(1H-benzimidazol-1-yl)phenyl]methanol × 3 DMS DIMETHYL SULFOXIDE × 5 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.36 Å R-free 0.226 |
| 7B86 Notum-Fragment067 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 AW7 2-[4-(1~{H}-pyrazol-3-yl)phenoxy]pyrimidine × 1 EDO 1,2-ETHANEDIOL × 16 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.40 Å R-free 0.215 |
| 7B87 Notum-Fragment074 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | DMS DIMETHYL SULFOXIDE × 2 EDO 1,2-ETHANEDIOL × 7 SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JFV methyl 2-(4-aminophenoxy)benzoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.58 Å R-free 0.241 |
| 7B89 Notum-Fragment077 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 T1Z [1-(3,4-dichlorophenyl)-1,2,3-triazol-4-yl]methanol × 1 EDO 1,2-ETHANEDIOL × 11 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.84 Å R-free 0.251 |
| 7B8A Notum-Fragment 110 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 AWP 1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea × 1 EDO 1,2-ETHANEDIOL × 8 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.23 Å R-free 0.212 |
| 7B8C Notum-Fragment 147 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 1 GRV 2-methyl-~{N}-(2-methylpropyl)imidazo[1,2-a]pyridine-3-carboxamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.43 Å R-free 0.234 |
| 7B8D Notum-Fragment 151 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 SFY 4-amino-N-(pyridin-2-yl)benzenesulfonamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.62 Å R-free 0.228 |
| 7B8F Notum-Fragment 154 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 3 RYM 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.62 Å R-free 0.236 |
| 7B8G Notum-Fragment 159 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 MJW 2-phenylmethoxyaniline × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.58 Å R-free 0.242 |
| 7B8J Notum-Fragment 163 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 BP4 biphenyl-4-ylacetic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.75 Å R-free 0.241 |
| 7B8K Notum-Fragment 173 Deposited 2020-12-12 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 1 AXV 1~{H}-benzimidazol-2-ylcyanamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
EVAPORATION;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.60 Å R-free 0.245 |
| 7B8L Notum-Fragment 174 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 3 AY4 2,4-bis(fluoranyl)-6-(1~{H}-pyrazol-3-yl)phenol × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.45 Å R-free 0.247 |
| 7B8M Notum-Fragment 193 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 1 GQM 5-methoxy-2-(1~{H}-pyrazol-3-yl)phenol × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.48 Å R-free 0.246 |
| 7B8N Notum-Fragment 197 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 1 EDO 1,2-ETHANEDIOL × 4 T2E 5-azanyl-2-(pyridin-3-ylmethylamino)benzoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.56 Å R-free 0.248 |
| 7B8O Notum-Fragment 199 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 4 T1W [(2~{S})-2-methylpiperidin-1-yl]-morpholin-4-yl-methanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.50 Å R-free 0.234 |
| 7B8U Notum-Fragment 201 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 RUY 4-(piperidin-1-yl)-1,2,5-oxadiazol-3-amine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.54 Å R-free 0.232 |
| 7B8X Notum-Fragment 210 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 U3K ~{N}-methyl-~{N}-[(5-methylfuran-2-yl)methyl]-1-phenyl-methanamine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.51 Å R-free 0.254 |
| 7B8Y Notum-Fragment 276 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 T2H 5-(3-ethoxyphenyl)-1,3,4-thiadiazol-2-amine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.57 Å R-free 0.245 |
| 7B8Z Notum-Fragment 277 Deposited 2020-12-13 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 A6Z 2-[4-(3-chlorophenyl)piperazin-1-ium-1-yl]ethanenitrile × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.73 Å R-free 0.243 |
| 7B98 Notum Fragment 282 Deposited 2020-12-14 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2 EJW (3-phenyl-1,2-oxazol-5-yl)methylazanium × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.53 Å R-free 0.235 |
| 7B99 Notum Fragment 283 Deposited 2020-12-14 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 9 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 B1A ~{N}-(4-phenylazanylphenyl)ethanamide × 1 DMS DIMETHYL SULFOXIDE × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.81 Å R-free 0.249 |
| 7B9D Notum Fragment 290 Deposited 2020-12-14 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 T3N 2-(4-acetamidophenoxy)ethanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.93 Å R-free 0.264 |
| 7B9I Notum Fragment 297 Deposited 2020-12-14 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 T3T 1-(1,3-benzodioxol-5-yl)-~{N}-(pyridin-2-ylmethyl)methanamine × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.34 Å R-free 0.231 |
| 7B9N Notum Fragment 588 Deposited 2020-12-14 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 3 N9J benzyl hydroxycarbamate × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.38 Å R-free 0.229 |
| 7B9U Notum Fragment 609 Deposited 2020-12-14 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 3 O3D 4-[(furan-2-yl)methyl]-1lambda~6~,4-thiazinane-1,1-dione × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.50 Å R-free 0.232 |
| 7BA1 Notum Fragment 634 Deposited 2020-12-15 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 S1V 1-ethanoylpiperidine-4-carbonitrile × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.93 Å R-free 0.264 |
| 7BAC Notum Fragment 646 Deposited 2020-12-15 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomer |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 LO5 1-(1,3-benzodioxol-5-yl)-~{N}-[[(2~{R})-oxolan-2-yl]methyl]methanamine × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.54 Å R-free 0.248 |
| 7BAP Notum Fragment 648 Deposited 2020-12-16 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 S4V ~{N}2-pyridin-2-ylbenzene-1,2-diamine × 2 DMS DIMETHYL SULFOXIDE × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.53 Å R-free 0.213 |
| 7BC8 Notum Fragment 658 Deposited 2020-12-18 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2 TAH 2-(benzyloxy)benzohydrazide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.74 Å R-free 0.238 |
| 7BC9 Notum Fragment 690 Deposited 2020-12-18 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 UR4 2-methoxy-N-(4-phenyl-1,3-thiazol-2-yl)acetamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.73 Å R-free 0.252 |
| 7BCC Notum Fragment 705 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 TB5 4-(4-pyrrol-1-ylphenyl)morpholine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.58 Å R-free 0.235 |
| 7BCD Notum Fragment 714 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 T9Z 2-(morpholin-4-ium-4-ylmethyl)naphthalen-1-ol × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.51 Å R-free 0.238 |
| 7BCE Notum Fragment 718 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 LDV 3-[(4-methylpiperidin-1-yl)methyl]-1H-indole × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.87 Å R-free 0.266 |
| 7BCF Notum Fragment 722 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 T9W 2-[4-(2,5-Dioxopyrrolidin-1-yl)phenoxy]acetate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.86 Å R-free 0.259 |
| 7BCH Notum Fragment 772 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 T9Q N-Benzyl-2-methoxyacetamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.70 Å R-free 0.247 |
| 7BCI Notum Fragment 784 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GVV ~{N}-(4-methyl-2-oxidanyl-phenyl)propanamide × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.94 Å R-free 0.248 |
| 7BCK Notum Fragment 791 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 2 T9B (2S)-N-(4-Methoxybenzyl)tetrahydrofuran-2-carboxamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.70 Å R-free 0.255 |
| 7BCL Notum Fragment 792 Deposited 2020-12-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 T9K methyl 2-(4-cyanophenoxy)ethanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.84 Å R-free 0.271 |
| 7BD2 Notum Fragment 810 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 2 NUM N-[2-(4-hydroxyphenyl)ethyl]pyridine-2-carboxamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.52 Å R-free 0.221 |
| 7BD3 Notum Fragment 823 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 TE5 4-methoxy-6-phenyl-pyrimidin-2-amine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;ETGSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRW
LLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFI
PYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLL
NVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNG
VVPERCRRQFQEGEEWNCFFGYKVYPTLRSPVFVVQWLFDEAQLTVDNVHLTGQPVQEGL
RLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTGTKHHHHHH
|
Resolution 1.91 Å R-free 0.265 |
| 7BD4 Notum Fragment 828 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JHJ N-(4-methoxyphenyl)-N'-pyridin-4-ylurea × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.80 Å R-free 0.231 |
| 7BD5 Notum Fragment 830 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 YI6 2-(4-ethoxyphenyl)ethanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.69 Å R-free 0.233 |
| 7BD6 Notum Fragment 863 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 3 JH7 1-methyl-5-(phenylamino)-1,2-dihydro-3H-pyrazol-3-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.70 Å R-free 0.220 |
| 7BD8 Notum Fragment 872 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 3 QL5 (2,5-dimethylphenyl) pyridine-4-carboxylate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.42 Å R-free 0.207 |
| 7BD9 Notum Fragment 886 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 GW1 (4-chloranyl-2-methyl-pyrazol-3-yl)-piperidin-1-yl-methanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.59 Å R-free 0.214 |
| 7BDA Notum Fragment 900 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 O1J (benzyloxy)acetic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.47 Å R-free 0.201 |
| 7BDB Notum Fragment 916 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 NW7 3-ethyl-5-methyl-N-(5-methyl-1,2-oxazol-3-yl)-1,2-oxazole-4-carboxamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.46 Å R-free 0.211 |
| 7BDC Notum Fragment 923 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 4 WNA 1-methyl-N-[(2-methylphenyl)methyl]-1H-tetrazol-5-amine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.32 Å R-free 0.205 |
| 7BDD Notum Fragment 924 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 TE8 (2~{R})-2-(4-phenylphenoxy)propanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.47 Å R-free 0.211 |
| 7BDF Notum Fragment 927 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 TEH 4-(2-phenoxyethanoyl)piperazin-2-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.40 Å R-free 0.215 |
| 7BDG Notum Fragment 934 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 TEK ~{N}-(1-ethylbenzimidazol-2-yl)ethanamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.60 Å R-free 0.243 |
| 7BDH Notum Fragment 955 Deposited 2020-12-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 TEZ N-(2,1,3-Benzothiadiazol-5-yl)acetamide × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.54 Å R-free 0.217 |
| 7BLI Notum-Bepridil complex Deposited 2021-01-18 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 BEP 1-ISOBUTOXY-2-PYRROLIDINO-3[N-BENZYLANILINO] PROPANE × 1 DMS DIMETHYL SULFOXIDE × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.47 Å R-free 0.234 |
| 7BLS Notum-maybridge_18 Deposited 2021-01-18 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 GOL GLYCEROL × 1 U2Q 2-[(3-Nitro-2-pyridyl)thio]acetic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.19 Å R-free 0.212 |
| 7BLT Notum_Maybridge_4 Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 U2T 3-(4-~{tert}-butylphenyl)-1,2,4-oxadiazole-5-carbohydrazide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.20 Å R-free 0.211 |
| 7BLU Notum_Maybridge_56 Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 GOL GLYCEROL × 1 U2W 4,5-dichloro-6-nitropyridazin-3(2H)-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.21 Å R-free 0.189 |
| 7BLW Notum_Piperine complex Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 AYR (2E,4E)-5-(2H-1,3-benzodioxol-5-yl)-1-(piperidin-1-yl)penta-2,4-dien-1-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.45 Å R-free 0.211 |
| 7BM1 Notum_Valsartan complex Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 6 U35 (2~{S})-3-methyl-2-[pentanoyl-[[4-[2-(2~{H}-1,2,3,4-tetrazol-5-yl)phenyl]phenyl]methyl]amino]butanoic acid × 1 DMS DIMETHYL SULFOXIDE × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.37 Å R-free 0.218 |
| 7BM3 Notum Rosmarinic acid complex Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 9 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 4 ROA (2R)-3-(3,4-dihydroxyphenyl)-2-{[(2E)-3-(3,4-dihydroxyphenyl)prop-2-enoyl]oxy}propanoic acid × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.40 Å R-free 0.221 |
| 7BM7 Notum fragment 5e Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 U3Q 1-Naphthalenepentanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.87 Å R-free 0.255 |
| 7BMB Notum PPOH complex Deposited 2021-01-19 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 GOL GLYCEROL × 1 U3T 6-(2-prop-2-ynoxyphenyl)hexanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.83 Å R-free 0.237 |
| 7BMD Notum TDZD8 complex Deposited 2021-01-20 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 11 GOL GLYCEROL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 U3W 2-methyl-4-(phenylmethyl)-1,2,4-thiadiazolidine-3,5-dione × 1 DMS DIMETHYL SULFOXIDE × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.45 Å R-free 0.187 |
| 7BN5 Notum fragment_1 (2-(isoquinolin-1-ylsulfanyl)acetic acid) Deposited 2021-01-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 3 GOL GLYCEROL × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 U4K 2-isoquinolin-1-ylsulfanylethanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 2.22 Å R-free 0.255 |
| 7BN8 Notum fragment_3 (4H,5H-naphtho[1,2-b]thiophene-2-carboxylic acid) Deposited 2021-01-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 U4T 4H,5H-naphtho[1,2-b]thiophene-2-carboxylic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.78 Å R-free 0.233 |
| 7BNB Notum fragment_50 (3-(quinazolin-4-ylsulfanyl)propanoic acid) Deposited 2021-01-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 3 U58 3-(quinazolin-4-ylsulfanyl)propanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.16 Å R-free 0.222 |
| 7BNC Notum fragment_126 (2-(1,2-dihydroacenaphthylen-5-ylsulfanyl)acetic acid) Deposited 2021-01-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 GOL GLYCEROL × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 U5B 2-(1,2-dihydroacenaphthylen-5-ylsulfanyl)ethanoic acid × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.86 Å R-free 0.244 |
| 7BND Notum_Fragment41 (N-methyl-4,5-dihydronaphtho,2-bthiophene-2-carboxamide) Deposited 2021-01-21 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 6 GOL GLYCEROL × 1 U5E N-methyl-4,5-dihydrobenzo[g]benzothiophene-2-carboxamide × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 2.10 Å R-free 0.246 |
| 7BNE Notum Nicotine Deposited 2021-01-22 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | GOL GLYCEROL × 2 SO4 SULFATE ION × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 NCT (S)-3-(1-METHYLPYRROLIDIN-2-YL)PYRIDINE × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.70 Å R-free 0.197 |
| 7BNF Notum Cotinine Deposited 2021-01-22 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 7 GOL GLYCEROL × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 U5H (5~{S})-1-methyl-5-pyridin-3-yl-pyrrolidin-2-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.45 Å R-free 0.180 |
| 7BNJ Notum Riluzole Deposited 2021-01-22 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 13 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 657 6-(trifluoromethoxy)-1,3-benzothiazol-2-amine × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.49 Å R-free 0.197 |
| 7BNL Notum ARUK3003710 Deposited 2021-01-22 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 3 EDO 1,2-ETHANEDIOL × 1 U5T (4~{E})-2-(3,4-dimethylphenyl)-4-[(1-methylpyrazol-4-yl)methylidene]-1,3-oxazol-5-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.23 Å R-free 0.198 |
| 7BO1 Notum Fragment_274 [(4-fluorophenyl)amino]thiourea Deposited 2021-01-23 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 GOL GLYCEROL × 1 EDO 1,2-ETHANEDIOL × 1 U5Z 1-[(4-fluorophenyl)amino]thiourea × 3 DMS DIMETHYL SULFOXIDE × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.40 Å R-free 0.216 |
| 7BO2 Notum Fragment_130 (4H-thieno[3,2-c]chromene-2-carboxylic acid) Deposited 2021-01-23 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 7 U62 4~{H}-thieno[3,2-c]chromene-2-carboxylic acid × 1 DMS DIMETHYL SULFOXIDE × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.21 Å R-free 0.219 |
| 7BO5 Notum Fragment_130_methyEster (methyl 4H-thieno[3,2-c]chromene-2-carboxylate) Deposited 2021-01-23 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 GOL GLYCEROL × 1 U65 methyl 3~{a},4-dihydro-3~{H}-thieno[3,2-c]chromene-2-carboxylate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.38 Å R-free 0.201 |
| 7PJR Notum_ARUK3000438 Deposited 2021-08-24 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 2 7SQ 1-[4-chloranyl-3-(trifluoromethyl)phenyl]-1,2,3-triazole × 1 SO4 SULFATE ION × 4 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.51 Å R-free 0.206 |
| 7PK3 Notum_ARUK3001185 Deposited 2021-08-25 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 7T0 1-[2,4-bis(chloranyl)-3-(trifluoromethyl)phenyl]-1,2,3-triazole × 1 DMS DIMETHYL SULFOXIDE × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.41 Å R-free 0.204 |
| 7PKV Notum_Inhibitor ARUK3000223 Deposited 2021-08-26 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 63Z [1-[4-chloranyl-3-(trifluoromethyl)phenyl]-1,2,3-triazol-4-yl]methanol × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.68 Å R-free 0.227 |
| 7QVZ ARUK3001043_Notum Deposited 2022-01-24 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2 SO4 SULFATE ION × 1 FNW [1-[2,4-bis(chloranyl)-3-(trifluoromethyl)phenyl]-1,2,3-triazol-4-yl]methanol × 1 DMS DIMETHYL SULFOXIDE × 2 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.47 Å R-free 0.217 |
| 8BSP Notum Inhibitor ARUK3006560 Deposited 2022-11-26 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 RD9 methyl 4-oxidanylidene-4-[4-(trifluoromethyl)-2,3-dihydroindol-1-yl]butanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.55 Å R-free 0.205 |
| 8BSQ Notum Inhibitor ARUK3006561 Deposited 2022-11-26 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 RDO ethyl 4-oxidanylidene-4-[4-(trifluoromethyl)-2,3-dihydroindol-1-yl]butanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.45 Å R-free 0.200 |
| 8BSR Notum Inhibitor ARUK3006562 Deposited 2022-11-26 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | SO4 SULFATE ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 DMS DIMETHYL SULFOXIDE × 1 RCU ethyl 4-[5-chloranyl-4-(trifluoromethyl)-2,3-dihydroindol-1-yl]-4-oxidanylidene-butanoate × 1 EDO 1,2-ETHANEDIOL × 3 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.45 Å R-free 0.206 |
| 8BSZ Notum Inhibitor ARUK3005522 Deposited 2022-11-27 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 6 RGU (3~{a}~{R})-2,3,3~{a},4-tetrahydropyrrolo[1,2-a]indol-1-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.70 Å R-free 0.220 |
| 8BT0 Notum Inhibitor ARUK3005518 Deposited 2022-11-27 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 6 RGO (3~{a}~{S})-2,2-bis(fluoranyl)-3~{a},4-dihydro-3~{H}-pyrrolo[1,2-a]indol-1-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.60 Å R-free 0.215 |
| 8BT2 Notum Inhibitor ARUK3004876 Deposited 2022-11-27 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 6 RG0 1-[5-chloranyl-4-(trifluoromethyl)-2,3-dihydroindol-1-yl]ethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.70 Å R-free 0.223 |
| 8BT5 Notum Inhibitor ARUK3004877 Deposited 2022-11-27 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 2 EDO 1,2-ETHANEDIOL × 4 REH 1-(4-fluoranylspiro[2~{H}-indole-3,1'-cyclobutane]-1-yl)ethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.40 Å R-free 0.204 |
| 8BT7 Notum Inhibitor ARUK3004903 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 6 RL6 1-[3,4-bis(chloranyl)-5-methyl-indol-1-yl]ethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.40 Å R-free 0.210 |
| 8BT8 Notum Inhibitor ARUK3004048 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 7 DMS DIMETHYL SULFOXIDE × 2 EDO 1,2-ETHANEDIOL × 4 RRI 1-indol-1-ylethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.28 Å R-free 0.208 |
| 8BTA Notum Inhibitor ARUK3004308 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 3 DMS DIMETHYL SULFOXIDE × 4 EDO 1,2-ETHANEDIOL × 2 RC6 1-(4-chloranyl-2,3-dihydroindol-1-yl)ethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.34 Å R-free 0.226 |
| 8BTC Notum Inhibitor ARUK3004558 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 3 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 4 RIQ 1-[4,5-bis(chloranyl)-2,3-dihydroindol-1-yl]ethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.54 Å R-free 0.230 |
| 8BTE Notum Inhibitor ARUK3004470 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 6 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 3 RIX methyl 2-(4-chloranylindol-1-yl)-2-oxidanylidene-ethanoate × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.62 Å R-free 0.233 |
| 8BTH Notum Inhibitor ARUK3004552 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 2 EDO 1,2-ETHANEDIOL × 3 RJ0 1-(2,3-dihydroindol-1-yl)prop-2-en-1-one × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.30 Å R-free 0.213 |
| 8BTI Notum Inhibitor ARUK3004556 Deposited 2022-11-28 | Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics | Assembly 1 Protein monomer Monomer;Protein × 1 PDB declaration: monomeric |
Chain A
81–451(371 aa)
|
Not recorded | NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 1 EDO 1,2-ETHANEDIOL × 8 RFO 1-(4-chloranylindol-1-yl)-2-methoxy-ethanone × 1 |
X-RAY DIFFRACTION
X-ray crystallization conditions
VAPOR DIFFUSION, SITTING DROP;pH 4.2;296 K;1.5 M Ammonium Sulphate
0.1 M Sodium Citrate, pH4.2
|
Resolution 1.31 Å R-free 0.218 |
140 other PDB entries and 149 assemblies. Open the comparison page and filter oligomeric states
View Construct and Data Evidence
| UniProt name | NOTUM_HUMAN |
| Isoform | — |
| PDB entities | 1 |
| Chains and sequence ranges | Author chain A; PDBConstruct 4–374; UniProt 81–451 |