SAXSdb — 7a8w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NBS-LRR class disease resistance protein

Oryza sativa subsp. japonica

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Uncharacterized protein × 1 （G4MXW3） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Uncharacterized protein × 1 （G4MXW3） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5L9G5_ORYSJ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 1–79； UniProt 183–261 Author chain BBB； PDBConstruct 1–79； UniProt 183–261 Author chain DDD； PDBConstruct 1–79； UniProt 183–261 Author chain EEE； PDBConstruct 1–79； UniProt 183–261

Uncharacterized protein

Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)

UniProt G4MXW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	NBS-LRR class disease resistance protein × 2 （D5L9G5） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	NBS-LRR class disease resistance protein × 2 （D5L9G5） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G4MXW3_MAGO7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain CCC； PDBConstruct 2–93； UniProt 22–113 Author chain FFF； PDBConstruct 2–93； UniProt 22–113

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7a8w
Deposition date deposition_date	2020-08-31
Structure title title	Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikC with an engineered HMA domain of Pikp-1 from rice (Oryza sativa)
Keywords keywords	Fungal effector, HMA domain, NLR protein, MAX effector, ANTIFUNGAL PROTEIN; ANTIFUNGAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7a8w__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7a8w__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7a8w__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.91 Å
Rg (electron density)	17.97 Å
Total Rg	18.97 Å
Atom count	3513
Residues	225
Excluded volume	31156 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7a8w__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7a8w__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	NBS-LRR class disease resistance protein
Molecular weight formula_weight	8622.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AAA,BBB,DDD,EEE
Atom count atom_count	7129

RKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVSQAKED

Source Source

Source organism organism	Oryza sativa subsp. japonica
Common name common_name	Rice
NCBI taxonomy ID ncbi_taxonomy_id	39947
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	10847.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CCC,FFF

METGNKYIEKRAIDLSRERDPNFFDNPGIPVPECFWFMFKNNVRQDDGTCYSSWKMDMKVGPNWVHIKSDDNCNLSGDFPPGWIVLGKKRPGF

Source Source

Source organism organism	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Common name common_name	Rice blast fungus
NCBI taxonomy ID ncbi_taxonomy_id	242507
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	78

▶

Unit-cell length a length_a	66.784 Å
Unit-cell length b length_b	80.205 Å
Unit-cell length c length_c	105.683 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.150 Å
Low-resolution limit resolution_low	44.165 Å
R factor r_factor	—
R_work r_work	0.2241
R_free r_free	0.2722

Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikC with an engineered HMA domain of Pikp-1 from rice (Oryza sativa)

1. Protein Identity and Related Structures Protein Identity & Related Structures

NBS-LRR class disease resistance protein

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7a8w__assembly_2__model_1

7a8w__assembly_2__model_1 | I(q)

7a8w__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikC with an engineered HMA domain of Pikp-1 from rice (Oryza sativa)

1. Protein Identity and Related Structures Protein Identity & Related Structures

NBS-LRR class disease resistance protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7a8w__assembly_2__model_1

7a8w__assembly_2__model_1 | I(q)

7a8w__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)