SAXSdb — 7b74

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin

Streptomyces avidinii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 4	;{N-(4-{[2-(amino-kappaN)ethyl]sulfamoyl-kappaN}phenyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide}(chloro)[(1,2,3,4,5-eta)-1,2,3,4,5-pentamethylcyclopentadienyl]iridium(III) ; × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SODC_MYCBO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 49–83； UniProt 196–230 Author chain BBB； PDBConstruct 49–83； UniProt 196–230 Author chain CCC； PDBConstruct 49–83； UniProt 196–230 Author chain DDD； PDBConstruct 49–83； UniProt 196–230

Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin

Streptomyces avidinii

UniProt P22629

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 4	;{N-(4-{[2-(amino-kappaN)ethyl]sulfamoyl-kappaN}phenyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide}(chloro)[(1,2,3,4,5-eta)-1,2,3,4,5-pentamethylcyclopentadienyl]iridium(III) ; × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SAV_STRAV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 15–48； UniProt 39–72 Author chain AAA； PDBConstruct 84–194； UniProt 73–183 Author chain BBB； PDBConstruct 15–48； UniProt 39–72 Author chain BBB； PDBConstruct 84–194； UniProt 73–183 Author chain CCC； PDBConstruct 15–48； UniProt 39–72 Author chain CCC； PDBConstruct 84–194； UniProt 73–183 Author chain DDD； PDBConstruct 15–48； UniProt 39–72 Author chain DDD； PDBConstruct 84–194； UniProt 73–183

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7b74
Deposition date deposition_date	2020-12-09
Structure title title	Chimeric Streptavidin With A Dimerization Domain For Artificial Transfer Hydrogenation
Keywords keywords	Artificial tranfer hydrogenation biotin-binding protein artificial metalloenzyme, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7b74__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7b74__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7b74__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.48 Å
Rg (electron density)	21.46 Å
Total Rg	22.27 Å
Atom count	7252
Residues	492
Excluded volume	66901 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7b74__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin
Molecular weight formula_weight	20111.8 kDa
EC 编号 ec_number	1.15.1.1
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AAA,BBB,CCC,DDD
Atom count atom_count	7478

MASMTGGQQMGRDQAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTAGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Source Source

Source organism organism	Streptomyces avidinii
NCBI taxonomy ID ncbi_taxonomy_id	1895
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	;{N-(4-{[2-(amino-kappaN)ethyl]sulfamoyl-kappaN}phenyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide}(chloro)[(1,2,3,4,5-eta)-1,2,3,4,5-pentamethylcyclopentadienyl]iridium(III) ;
Molecular weight formula_weight	807.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	177

▶

Unit-cell length a length_a	57.285 Å
Unit-cell length b length_b	57.307 Å
Unit-cell length c length_c	88.035 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	94.62 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	47.980 Å
R factor r_factor	—
R_work r_work	0.1910
R_free r_free	0.2176

Chimeric Streptavidin With A Dimerization Domain For Artificial Transfer Hydrogenation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin

State in the Current Structure

Other States of the Same Protein in the Database

Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7b74__assembly_1__model_1

7b74__assembly_1__model_1 | I(q)

7b74__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Chimeric Streptavidin With A Dimerization Domain For Artificial Transfer Hydrogenation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7b74__assembly_1__model_1

7b74__assembly_1__model_1 | I(q)

7b74__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)