SAXSdb — 7bdw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Possible 4'-phosphopantetheinyl transferase ;

Mycobacterium tuberculosis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Phthiocerol synthesis polyketide synthase type I PpsC × 1 （A0A2I7WB16） COENZYME A × 1 N-(2,6-diethylphenyl)-N'-(N-ethylcarbamimidoyl)urea × 1 MANGANESE (II) ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B1MD73_MYCA9
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–219； UniProt 1–219

Phthiocerol synthesis polyketide synthase type I PpsC

Mycobacterium tuberculosis

UniProt A0A2I7WB16

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	;Possible 4'-phosphopantetheinyl transferase ; × 1 （B1MD73） COENZYME A × 1 N-(2,6-diethylphenyl)-N'-(N-ethylcarbamimidoyl)urea × 1 MANGANESE (II) ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I7WB16_MYCTX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 25–153； UniProt 67–195

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bdw
Deposition date deposition_date	2020-12-22
Structure title title	Crystal structure of mycobacterial PptAb in complex with ACP and compound 8918
Keywords keywords	Pseudomonas aeruginosa, transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bdw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bdw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bdw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.84 Å
Rg (electron density)	18.72 Å
Total Rg	19.60 Å
Atom count	2282
Residues	293
Excluded volume	40773 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bdw__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	;Possible 4'-phosphopantetheinyl transferase ;
Molecular weight formula_weight	25432.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2290

MPVTDQLIASVVPELLPSAELYEDPPGLEPLPEEEPLIAKSVAKRRNEFITVRYCARQALSVLGIPEVPILKGDKGQPLWPDGIVGSMTHTEGFRGAVVGRTGEVRSVGIDAEPHDVLPNGVLKSIALPVERDELDALPAGTHWDRLLFCAKETTYKAWFPLTARWLGFEDAHITIDPDGTFTSRILVDGRANDGTVLSAFDGRWIIDKGLILTAIVVPKLAAALEHHHHHH

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	1773
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Phthiocerol synthesis polyketide synthase type I PpsC
Molecular weight formula_weight	16791.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGSSHHHHHHSSGLVPRGSHMAIRAQLDALDAAERPGHLASAIADEIRAVLRSGDPIDHHRPLETLGLDALMGLELRNRLEASLGITLPVALVWAYPTISDLATALCERMDYATPAAAQEISDTEPELSDEEMDLLADLVDASELEAATRGESTSGS

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	1773
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	COENZYME A
Molecular weight formula_weight	767.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	N-(2,6-diethylphenyl)-N'-(N-ethylcarbamimidoyl)urea
Molecular weight formula_weight	262.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	8

▶

Unit-cell length a length_a	50.840 Å
Unit-cell length b length_b	63.037 Å
Unit-cell length c length_c	108.566 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.550 Å
Low-resolution limit resolution_low	41.130 Å
R factor r_factor	0.2163
R_work r_work	0.2119
R_free r_free	0.2554

Crystal structure of mycobacterial PptAb in complex with ACP and compound 8918

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Possible 4'-phosphopantetheinyl transferase ;

State in the Current Structure

Other States of the Same Protein in the Database

Phthiocerol synthesis polyketide synthase type I PpsC

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bdw__assembly_1__model_1

7bdw__assembly_1__model_1 | I(q)

7bdw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Crystal structure of mycobacterial PptAb in complex with ACP and compound 8918

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Possible 4'-phosphopantetheinyl transferase ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phthiocerol synthesis polyketide synthase type I PpsC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bdw__assembly_1__model_1

7bdw__assembly_1__model_1 | I(q)

7bdw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)