SAXSdb — 7cgp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit Tim22

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Acylglycerol kinase, mitochondrial × 1 （Q53H12） Mitochondrial import inner membrane translocase subunit Tim29 × 1 （Q9BSF4） Mitochondrial import inner membrane translocase subunit Tim9 × 5 （Q9Y5J7） Mitochondrial import inner membrane translocase subunit Tim10 × 6 （P62072） Mitochondrial import inner membrane translocase subunit Tim10 B × 1 （Q9Y5J6） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM22_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–194； UniProt 1–194

Acylglycerol kinase, mitochondrial

Homo sapiens

UniProt Q53H12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import inner membrane translocase subunit Tim22 × 1 （Q9Y584） Mitochondrial import inner membrane translocase subunit Tim29 × 1 （Q9BSF4） Mitochondrial import inner membrane translocase subunit Tim9 × 5 （Q9Y5J7） Mitochondrial import inner membrane translocase subunit Tim10 × 6 （P62072） Mitochondrial import inner membrane translocase subunit Tim10 B × 1 （Q9Y5J6） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AGK_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–422； UniProt 1–422

Mitochondrial import inner membrane translocase subunit Tim29

Homo sapiens

UniProt Q9BSF4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import inner membrane translocase subunit Tim22 × 1 （Q9Y584） Acylglycerol kinase, mitochondrial × 1 （Q53H12） Mitochondrial import inner membrane translocase subunit Tim9 × 5 （Q9Y5J7） Mitochondrial import inner membrane translocase subunit Tim10 × 6 （P62072） Mitochondrial import inner membrane translocase subunit Tim10 B × 1 （Q9Y5J6） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM29_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–260； UniProt 1–260

Mitochondrial import inner membrane translocase subunit Tim9

Homo sapiens

UniProt Q9Y5J7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import inner membrane translocase subunit Tim22 × 1 （Q9Y584） Acylglycerol kinase, mitochondrial × 1 （Q53H12） Mitochondrial import inner membrane translocase subunit Tim29 × 1 （Q9BSF4） Mitochondrial import inner membrane translocase subunit Tim10 × 6 （P62072） Mitochondrial import inner membrane translocase subunit Tim10 B × 1 （Q9Y5J6） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM9_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–89； UniProt 1–89 Author chain E； PDBConstruct 1–89； UniProt 1–89 Author chain F； PDBConstruct 1–89； UniProt 1–89 Author chain K； PDBConstruct 1–89； UniProt 1–89 Author chain L； PDBConstruct 1–89； UniProt 1–89

Mitochondrial import inner membrane translocase subunit Tim10

Homo sapiens

UniProt P62072

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import inner membrane translocase subunit Tim22 × 1 （Q9Y584） Acylglycerol kinase, mitochondrial × 1 （Q53H12） Mitochondrial import inner membrane translocase subunit Tim29 × 1 （Q9BSF4） Mitochondrial import inner membrane translocase subunit Tim9 × 5 （Q9Y5J7） Mitochondrial import inner membrane translocase subunit Tim10 B × 1 （Q9Y5J6） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM10_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–90； UniProt 1–90 Author chain H； PDBConstruct 1–90； UniProt 1–90 Author chain I； PDBConstruct 1–90； UniProt 1–90 Author chain M； PDBConstruct 1–90； UniProt 1–90 Author chain N； PDBConstruct 1–90； UniProt 1–90 Author chain O； PDBConstruct 1–90； UniProt 1–90

Mitochondrial import inner membrane translocase subunit Tim10 B

Homo sapiens

UniProt Q9Y5J6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import inner membrane translocase subunit Tim22 × 1 （Q9Y584） Acylglycerol kinase, mitochondrial × 1 （Q53H12） Mitochondrial import inner membrane translocase subunit Tim29 × 1 （Q9BSF4） Mitochondrial import inner membrane translocase subunit Tim9 × 5 （Q9Y5J7） Mitochondrial import inner membrane translocase subunit Tim10 × 6 （P62072） 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T10B_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–103； UniProt 1–103

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7cgp
Deposition date deposition_date	2020-07-01
Structure title title	Cryo-EM structure of the human mitochondrial translocase TIM22 complex at 3.7 angstrom.
Keywords keywords	human mitochondrial translocase TIM22 complex, inner membrane, chaperone Tim9/10a, chaperone Tim9/10a/10b, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7cgp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7cgp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7cgp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.63 Å
Rg (electron density)	48.28 Å
Total Rg	48.13 Å
Atom count	12433
Residues	1569
Excluded volume	221500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7cgp__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Mitochondrial import inner membrane translocase subunit Tim22
Molecular weight formula_weight	20048.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12433

MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Acylglycerol kinase, mitochondrial
Molecular weight formula_weight	47196.0 kDa
EC 编号 ec_number	2.7.1.107,2.7.1.138,2.7.1.94
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATLAIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSPTQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Mitochondrial import inner membrane translocase subunit Tim29
Molecular weight formula_weight	29272.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAAAALRRFWSRRRAEAGDAVVAKPGVWARLGSWARALLRDYAEACRDASAEARARPGRAAVYVGLLGGAAACFTLAPSEGAFEEALLEASGTLLLLAPATRNRESEAFVQRLLWLRGRGRLRYVNLGLCSLVYEAPFDAQASLYQARCRYLQPRWTDFPGRVLDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQAHSLVQAEAPR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Mitochondrial import inner membrane translocase subunit Tim9
Molecular weight formula_weight	10391.9 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F,K,L

MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Mitochondrial import inner membrane translocase subunit Tim10
Molecular weight formula_weight	10349.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,M,N,O

MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Mitochondrial import inner membrane translocase subunit Tim10 B
Molecular weight formula_weight	11601.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 non-polymer

Description description	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
Molecular weight formula_weight	744.0 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	7cgpJ01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	7cgpL01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	482959

Cryo-EM structure of the human mitochondrial translocase TIM22 complex at 3.7 angstrom.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit Tim22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acylglycerol kinase, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit Tim29

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit Tim9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit Tim10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit Tim10 B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7cgp__assembly_1__model_1

7cgp__assembly_1__model_1 | I(q)

7cgp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains